Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gamma-secretase subunit APH-1A (APH1A), partial

Product Specifications

Product Name Alternative

Aph-1alpha Presenilin-stabilization factor

Abbreviation

Recombinant Human APH1A protein, partial

Gene Name

APH1A

UniProt

Q96BI3

Expression Region

235-265aa

Organism

Homo sapiens (Human)

Target Sequence

SLRSIQRSLLCRRQEDSRVMVYSALRIPPED

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein) . It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.1 kDa

References & Citations

"Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microscope slide, pink frost
1304P-144 144/Box

Microscope slide, pink frost

Sign In for Pricing
View Details
Recombinant Mouse Cardiotrophin-1 (CT-1)
438-CT-050 50 µg

Recombinant Mouse Cardiotrophin-1 (CT-1)

Sign In for Pricing
View Details
SLC25A17 Protein Vector (Mouse) (pPM-C-His)
PV230137 500 ng

SLC25A17 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
H2AFX (Histone H2A.x, H2a/x, H2AX) (MaxLight 550)
127693-ML550 100 µL

H2AFX (Histone H2A.x, H2a/x, H2AX) (MaxLight 550)

Sign In for Pricing
View Details
CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)
MBS6444606-01 0.1 mL

CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)

Sign In for Pricing
View Details
CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)
MBS6444606-02 5x 0.1 mL

CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)

Sign In for Pricing
View Details