Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKP1, Human (Biotinylated, HEK293, His-Avi)

The SKP1 protein is a component of the SCF ubiquitin ligase complex and targets cell cycle progression and signal transduction. SKP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SKP1 protein, expressed by HEK293 , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

SKP1 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/skp1-protein-human-biotinylated-his-avi.html

Purity

95.00

Smiles

PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Molecular Formula

6500 (Gene_ID) P63208 (P2-K163) (Accession)

Molecular Weight

23-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)
MBS4381342-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)
MBS4381342-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)
MBS4381342-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)
MBS4381342-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)
MBS4381342-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker)

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) csnk1db Polyclonal Antibody
MBS7198258 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) csnk1db Polyclonal Antibody

Sign In for Pricing
View Details