Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-40 Protein

Product Specifications

Product Name Alternative

(Interleukin-40) (IL-40)

Abbreviation

Recombinant Mouse IL40 protein

UniProt

Q9CX63

Expression Region

19-252aa

Organism

Mus musculus (Mouse)

Target Sequence

EEQTEGITIAYKVLEVYPQSRRVLITCDAPEASQPITYSLLASRGILVAKKVVHDSVPASFNINITIKSSPDLLTYSCQATSNSGTYGPSSRLQMYQELWAKPVSQLQADFVLRHGDSGPTVELSCLASSGSPPITYRLVGNGGRVLAQQRPLHGKPANFSLPLSQTTGWFQCEAENDVGVDSSARIPLPRAEARAKLVTTLAGELPLTPTCILAGSLVSIAVIASRMLSSTGL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Probable B cell-associated cytokine that plays a role in the regulation of humoral immune responses. Involved in lymphocyte B cell development and immunoglobulin/IgA production.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

"Identification of IL-40, a novel B cell-associated cytokine." Catalan-Dibene J., Vazquez M.I., Luu V.P., Nuccio S.P., Karimzadeh A., Kastenschmidt J.M., Villalta S.A., Ushach I., Pone E.J., Casali P., Raffatellu M., Burkhardt A.M., Hernandez-Ruiz M., Heller G., Hevezi P.A., Zlotnik A. J. Immunol. 199:3326-3335 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)
239754-01 100 mg

Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)

Sign In for Pricing
View Details
Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)
239754-02 250 mg

Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)

Sign In for Pricing
View Details
Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)
239754-03 1 g

Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)

Sign In for Pricing
View Details
Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)
239754-04 5 g

Methyl 6-bromo-1H-indole-2-carboxylate 99+% (HPLC)

Sign In for Pricing
View Details
Valosin Containing Protein (VCP) Antibody
abx178832-01 200 µg

Valosin Containing Protein (VCP) Antibody

Sign In for Pricing
View Details
Valosin Containing Protein (VCP) Antibody
abx178832-02 1 mg

Valosin Containing Protein (VCP) Antibody

Sign In for Pricing
View Details