Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Uncharacterized protein C16orf59, C16orf59 ELISA KIT

Product Specifications

CAS Number

7732-18-5

Shipping Conditions

2-8°C

Storage Conditions

According to the label

Shipping Temperature

2-8°C

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C11orf1 shRNA (UAS) - Lentiviral human C11orf1 shRNA (UAS, GFP) (25)
GTR15161336 1 Vial

Lentiviral human C11orf1 shRNA (UAS) - Lentiviral human C11orf1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TCEA3 (Transcription Elongation Factor A (SII), 3, TFIIS, TFIIS.H) (AP)
MBS6162039-01 0.1 mL

TCEA3 (Transcription Elongation Factor A (SII), 3, TFIIS, TFIIS.H) (AP)

Sign In for Pricing
View Details
TCEA3 (Transcription Elongation Factor A (SII), 3, TFIIS, TFIIS.H) (AP)
MBS6162039-02 5x 0.1 mL

TCEA3 (Transcription Elongation Factor A (SII), 3, TFIIS, TFIIS.H) (AP)

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
ITGAD Antibody
A17921-100UG 100 µg

ITGAD Antibody

Sign In for Pricing
View Details