Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) , partial (H294F, H296F, Y297C, H305F)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lrpap1

UniProt

P55302

Expression Region

248-360aa (H294F, H296F, Y297C, H305F)

Organism

Mus musculus

Target Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Field of Research

Metabolism

Assay Type

In Stock Protein

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep OB(Obestatin)ELISA Kit
MBS2516182-01 24 Tests

Sheep OB(Obestatin)ELISA Kit

Sign In for Pricing
View Details
Sheep OB(Obestatin)ELISA Kit
MBS2516182-02 48 Test

Sheep OB(Obestatin)ELISA Kit

Sign In for Pricing
View Details
Sheep OB(Obestatin)ELISA Kit
MBS2516182-03 96 Tests

Sheep OB(Obestatin)ELISA Kit

Sign In for Pricing
View Details
Sheep OB(Obestatin)ELISA Kit
MBS2516182-04 5x 96 Tests

Sheep OB(Obestatin)ELISA Kit

Sign In for Pricing
View Details
Sheep OB(Obestatin)ELISA Kit
MBS2516182-05 10x 96 Tests

Sheep OB(Obestatin)ELISA Kit

Sign In for Pricing
View Details
LRRC67 (PPP1R42) Human siRNA Oligo Duplex (Locus ID 286187)
SR317300 1 Kit

LRRC67 (PPP1R42) Human siRNA Oligo Duplex (Locus ID 286187)

Sign In for Pricing
View Details