Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc, solution)

Product Specifications

UNSPSC Description

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc, solution) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Human (HEK293, hFc, solution) is 72 a.a., with molecular weight of ~38.77 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc.html

Purity

95.10

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Weight

Approximately 38.77 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF705D Mouse Monoclonal Antibody [Clone ID: OTI1G1]
CF810709 100 µg

ZNF705D Mouse Monoclonal Antibody [Clone ID: OTI1G1]

Sign In for Pricing
View Details
KDM3B Recombinant Rabbit monoclonal Antibody
HA750569 100 µL

KDM3B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SLURP1 Antibody (Biotin)
KB-8336-01 50 μL

SLURP1 Antibody (Biotin)

Sign In for Pricing
View Details
SLURP1 Antibody (Biotin)
KB-8336-02 100 µL

SLURP1 Antibody (Biotin)

Sign In for Pricing
View Details
SLURP1 Antibody (Biotin)
KB-8336-03 1 mL

SLURP1 Antibody (Biotin)

Sign In for Pricing
View Details
1-Dodecyne
TRC-D262735-2.5G 2.5 g

1-Dodecyne

Sign In for Pricing
View Details