Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc, solution)

Product Specifications

UNSPSC Description

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc, solution) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Human (HEK293, hFc, solution) is 72 a.a., with molecular weight of ~38.77 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc.html

Purity

95.10

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Weight

Approximately 38.77 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myeloid zinc finger 1 (MZF1) Human Gene Knockout Kit (CRISPR)
KN202865 1 Kit

Myeloid zinc finger 1 (MZF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Genomic DNA, Cecum
CD564134 5 µg

Tissue Genomic DNA, Cecum

Sign In for Pricing
View Details
SF3A3 Recombinant Rabbit Monoclonal Antibody [JE64-15]
HA721114 100 µL

SF3A3 Recombinant Rabbit Monoclonal Antibody [JE64-15]

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF405S conjugate, 0.1mg/mL
BNC041461-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGM2L1 Mouse Monoclonal Antibody [Clone ID: OTI2D12]
CF812135 100 µg

PGM2L1 Mouse Monoclonal Antibody [Clone ID: OTI2D12]

Sign In for Pricing
View Details
Tissue Total RNA, Omentum
CR559372 5 µg

Tissue Total RNA, Omentum

Sign In for Pricing
View Details