Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc, solution)

Product Specifications

UNSPSC Description

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc, solution) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Human (HEK293, hFc, solution) is 72 a.a., with molecular weight of ~38.77 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc.html

Purity

95.10

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Weight

Approximately 38.77 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGF Rabbit Polyclonal Antibody
AP20662PU-N 100 µg

EGF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBF1 (UBTF) (NM_001076684) Human Over-expression Lysate
LC421361 20 µg

UBF1 (UBTF) (NM_001076684) Human Over-expression Lysate

Sign In for Pricing
View Details
ROR gamma (RORC) Mouse Monoclonal Antibody [Clone ID: OTI3C9]
CF809572 100 µg

ROR gamma (RORC) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

Sign In for Pricing
View Details
NOBOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C5]
TA808379AM 100 µL

NOBOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C5]

Sign In for Pricing
View Details
7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid
TRC-H829190-25MG 25 mg

7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid

Sign In for Pricing
View Details
Anecortave
TRC-A637640-25MG 25 mg

Anecortave

Sign In for Pricing
View Details