GIP, Human (HEK293, hFc, solution)
Product Specifications
UNSPSC Description
The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc, solution) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Human (HEK293, hFc, solution) is 72 a.a., with molecular weight of ~38.77 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc.html
Purity
95.10
Smiles
EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Molecular Weight
Approximately 38.77 kDa
Shipping Conditions
Dry Ice
Storage Conditions
Stored at -80°C for 1 year
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E918115-50MG 50 mg
2-(2-(3-(N-Ethylacetamido)phenyl)-1,3-dioxolan-2-yl)acetic Acid
Sign In for Pricing
View Details 
BNC740198-500 1x 500 µL
Cytokeratin 18 (DA7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
