Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)
MBS6469055-01 0.1 mL

CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)

Sign In for Pricing
View Details
CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)
MBS6469055-02 5x 0.1 mL

CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal CA125/MUC16 Antibody (OTI3C6) [Dylight 594]
NBP2-72337DL594 0.1 mL

Mouse Monoclonal CA125/MUC16 Antibody (OTI3C6) [Dylight 594]

Sign In for Pricing
View Details
Anti-MRP-L16 antibody
STJ94214 200 µl

Anti-MRP-L16 antibody

Sign In for Pricing
View Details
Anti-AS160 / TBC1D4 antibody
STJ71082 100 µg

Anti-AS160 / TBC1D4 antibody

Sign In for Pricing
View Details
Rabbit anti-Bacillus subtilis (strain 168) ctaB2 Polyclonal Antibody
MBS9016751 Inquire

Rabbit anti-Bacillus subtilis (strain 168) ctaB2 Polyclonal Antibody

Sign In for Pricing
View Details