Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD28 Antibody (204-12) [Biotin]
NBP2-54769B 0.1 mL

Mouse Monoclonal CD28 Antibody (204-12) [Biotin]

Sign In for Pricing
View Details
Cathepsin D Activity Fluorometric Assay Kit
K143-100 100 Assays

Cathepsin D Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
S100A14 (S100 Calcium Binding Protein A14, S100-A14, S100-A15, S100A15, BCMP84, S114)
333298 100 µL

S100A14 (S100 Calcium Binding Protein A14, S100-A14, S100-A15, S100A15, BCMP84, S114)

Sign In for Pricing
View Details
DHRS6 Lentiviral Activation Particles (h)
sc-417965-LAC 200 µL

DHRS6 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
D-Valinol
HY-30167-01 10 g

D-Valinol

Sign In for Pricing
View Details
D-Valinol
HY-30167-02 25 g

D-Valinol

Sign In for Pricing
View Details