Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Anti-Human TIMP-1 Rabbit Polyclonal Antibody
TA328448 50 µg

Biotinylated Anti-Human TIMP-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila pdxH Protein
VAng-Lsx1048-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Hydrophila pdxH Protein

Sign In for Pricing
View Details
Pak6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6612105 3x 1.0 µg

Pak6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human anti-Pyr c 4 IgE
E4A11Y20-E 50 µg

Human anti-Pyr c 4 IgE

Sign In for Pricing
View Details
Urocortin 3 (Urocortin-3, UCN3, Urocortin III, Ucn III, UCNIII, MGC119002, Stresscopin, SCP, SPC) (Carboxyfluorescein)
U2575-32C 100 µL

Urocortin 3 (Urocortin-3, UCN3, Urocortin III, Ucn III, UCNIII, MGC119002, Stresscopin, SCP, SPC) (Carboxyfluorescein)

Sign In for Pricing
View Details
(2R,3R) -1-Ethyl-6-oxo-2-phenyl-piperidine-3-carboxylic Acid
421672-01 25 mg

(2R,3R) -1-Ethyl-6-oxo-2-phenyl-piperidine-3-carboxylic Acid

Sign In for Pricing
View Details