Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZBTB7A/Pokemon Antibody [DyLight 755]
NB100-761IR 0.1 mL

Rabbit Polyclonal ZBTB7A/Pokemon Antibody [DyLight 755]

Sign In for Pricing
View Details
Abametapir 5g
A15945-5000 5000 mg

Abametapir 5g

Sign In for Pricing
View Details
FMRF amide [D-Met2] (Phe-D-Met-Arg-Phe-NH2)
MBS658344-01 1 mg

FMRF amide [D-Met2] (Phe-D-Met-Arg-Phe-NH2)

Sign In for Pricing
View Details
FMRF amide [D-Met2] (Phe-D-Met-Arg-Phe-NH2)
MBS658344-02 5x 1 mg

FMRF amide [D-Met2] (Phe-D-Met-Arg-Phe-NH2)

Sign In for Pricing
View Details
Calretinin (CR, 29kD Calbindin, CAB29, CAL2, CALB2, Calbindin 2 29kDa, Calbindin-2, Calbindin D29K) discontinued
C1036-03G 50 µg

Calretinin (CR, 29kD Calbindin, CAB29, CAL2, CALB2, Calbindin 2 29kDa, Calbindin-2, Calbindin D29K) discontinued

Sign In for Pricing
View Details
Tas2r104 (NM_001166681) Rat Untagged Clone
RN216291 10 µg

Tas2r104 (NM_001166681) Rat Untagged Clone

Sign In for Pricing
View Details