Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rotavirus A/RV-A VP6 Polyclonal Antibody
PVV20101 100 μg

Anti-Rotavirus A/RV-A VP6 Polyclonal Antibody

Sign In for Pricing
View Details
Hoxc12 (NM_010463) Mouse Tagged ORF Clone Lentiviral Particle
MR219859L4V 200 µL

Hoxc12 (NM_010463) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human FN1 knockdown cell line
ABC-KD5627 1 Vial

Human FN1 knockdown cell line

Sign In for Pricing
View Details
Tissue, Section, Human Tumor, Stomach Tumor, Signet, Ring Cell Carcinoma (Paraffin) HisTekTM
T5595-5783 5 Sections

Tissue, Section, Human Tumor, Stomach Tumor, Signet, Ring Cell Carcinoma (Paraffin) HisTekTM

Sign In for Pricing
View Details
Rabbit Polyclonal GBAS Antibody [DyLight 350]
NBP1-76966UV 0.1 mL

Rabbit Polyclonal GBAS Antibody [DyLight 350]

Sign In for Pricing
View Details
Mouse 1700012B09Rik (NM_029306) AAV Particle
MR200593A1V 250 µL

Mouse 1700012B09Rik (NM_029306) AAV Particle

Sign In for Pricing
View Details