Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human C8orf4 pAb
PA14637-01 50 μL

Rabbit Anti-Human C8orf4 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human C8orf4 pAb
PA14637-02 100 μL

Rabbit Anti-Human C8orf4 pAb

Sign In for Pricing
View Details
Psma3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37941116 3x 1.0 µg

Psma3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
LPIN1 Polyclonal Antibody
RA33109-01 50 µL

LPIN1 Polyclonal Antibody

Sign In for Pricing
View Details
LPIN1 Polyclonal Antibody
RA33109-02 100 µL

LPIN1 Polyclonal Antibody

Sign In for Pricing
View Details
MSH6 (NM_001281494) Human Tagged ORF Clone
RC239925 10 µg

MSH6 (NM_001281494) Human Tagged ORF Clone

Sign In for Pricing
View Details