Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nt5e shRNA (UAS) - Lentiviral mouse Nt5e shRNA (UAS, iRFP) (100)
GTR15260967 1 Vial

Lentiviral mouse Nt5e shRNA (UAS) - Lentiviral mouse Nt5e shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
ZNF334 sgRNA CRISPR Lentivector (Human) (Target 2)
K2700503 1.0 µg DNA

ZNF334 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CD5 Mouse Monoclonal Antibody [Clone ID: LBI8C10]
AMM15346V 100 µL

CD5 Mouse Monoclonal Antibody [Clone ID: LBI8C10]

Sign In for Pricing
View Details
Rat Mouse CD4 (PE/Cy5)
MBS8559263-01 0.1 mL

Rat Mouse CD4 (PE/Cy5)

Sign In for Pricing
View Details
Rat Mouse CD4 (PE/Cy5)
MBS8559263-02 0.1 mL (AF405L)

Rat Mouse CD4 (PE/Cy5)

Sign In for Pricing
View Details
Rat Mouse CD4 (PE/Cy5)
MBS8559263-03 0.1 mL (AF405S)

Rat Mouse CD4 (PE/Cy5)

Sign In for Pricing
View Details