Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD80 (CD80 Antigen, CD80 Molecule, Activation B7-1 Antigen, B-lymphocyte Activation Antigen B7, B7, BB1, CD28 Antigen Ligand 1 B7-1 Antigen, CD28LG, CD28LG1, Costimulatory Factor CD80, CTLA-4 Counter-receptor B7.1, LAB7, T lymphocyte Activation Antigen CD80) (MaxLight 650) discontinued
C2432-01Q-ML650 100 µL

CD80 (CD80 Antigen, CD80 Molecule, Activation B7-1 Antigen, B-lymphocyte Activation Antigen B7, B7, BB1, CD28 Antigen Ligand 1 B7-1 Antigen, CD28LG, CD28LG1, Costimulatory Factor CD80, CTLA-4 Counter-receptor B7.1, LAB7, T lymphocyte Activation Antigen CD80) (MaxLight 650) discontinued

Sign In for Pricing
View Details
COPZ2 (NM_016429) Human Over-expression Lysate
LY414016 100 µg

COPZ2 (NM_016429) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal mGluR2 Antibody (455310) [Janelia Fluor 525]
FAB4676JF525 0.1 mL

Mouse Monoclonal mGluR2 Antibody (455310) [Janelia Fluor 525]

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody [Clone ID: LBI4G1]
AMM13574V 100 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody [Clone ID: LBI4G1]

Sign In for Pricing
View Details
CYB5R4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0542406 1.0 µg DNA

CYB5R4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Phospho-PI3 Kinase p110 beta (Ser1070) Polyclonal Antibody, Biotin Conjugated
bs-6417R-Biotin 100 µL

Phospho-PI3 Kinase p110 beta (Ser1070) Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details