Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABAT Mouse Monoclonal Antibody [Clone ID: UMLBI180]
AMM21917VCF 100 µg

ABAT Mouse Monoclonal Antibody [Clone ID: UMLBI180]

Sign In for Pricing
View Details
STAT5A/B Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-63080R-BF405 100 µL

STAT5A/B Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Human Cytochrome c (Cyt-C) ELISA Kit
AE48158HU-01 48 Tests

Human Cytochrome c (Cyt-C) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome c (Cyt-C) ELISA Kit
AE48158HU-02 96 Tests

Human Cytochrome c (Cyt-C) ELISA Kit

Sign In for Pricing
View Details
P2rx7 3'UTR Luciferase Stable Cell Line
TU215727 1.0 mL

P2rx7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SLCO2B1 Protein Vector (Mouse) (pPB-N-His)
PV231503 500 ng

SLCO2B1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details