Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Presqualene diphosphate phosphatase (PPAPDC2), partial
MBS7092698 Inquire

Recombinant Human Presqualene diphosphate phosphatase (PPAPDC2), partial

Sign In for Pricing
View Details
pEnCMV-IGF2BP2-3XFLAG-SV40-Neo Plasmid
PVT32778 2 µg

pEnCMV-IGF2BP2-3XFLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
pIRES2-EGFP-Flag-ELP3-HA Plasmid
PVTB00264-2g 2 µg

pIRES2-EGFP-Flag-ELP3-HA Plasmid

Sign In for Pricing
View Details
Recombinant Human C1R Protein, His (Fc)-Avi-tagged
C1R-2571H 50 µg

Recombinant Human C1R Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Human DNA replication complex GINS protein PSF2
MBS9421485-01 0.02 mg

Recombinant Human DNA replication complex GINS protein PSF2

Sign In for Pricing
View Details
Recombinant Human DNA replication complex GINS protein PSF2
MBS9421485-02 0.1 mg

Recombinant Human DNA replication complex GINS protein PSF2

Sign In for Pricing
View Details