Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL2RA Antibody (basiliximab biosimilar) (CHI621)
12-9103-100 100 µg

Anti-IL2RA Antibody (basiliximab biosimilar) (CHI621)

Sign In for Pricing
View Details
Btnl4 Protein Vector (Rat) (pPB-N-His)
PV256755 500 ng

Btnl4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
FGFR3 (NM_000142) Human Tagged Lenti ORF Clone
RC215533L3 10 µg

FGFR3 (NM_000142) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DBD-CO-Hz
sc-489817 100 mg

DBD-CO-Hz

Sign In for Pricing
View Details
4-BROMO-5-METHYL-1H-1,2,3-BENZOTRIAZOLE
JH913101 1 Each

4-BROMO-5-METHYL-1H-1,2,3-BENZOTRIAZOLE

Sign In for Pricing
View Details
hsa-miR-4639-3p miRNA Antagomir
MBS8317374-01 10 nmol

hsa-miR-4639-3p miRNA Antagomir

Sign In for Pricing
View Details