Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Umps sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3361102 1.0 µg DNA

Umps sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Actin, Smooth Muscle (ACTA2, Actin Alpha 2 Smooth Muscle Aorta, Actin Aortic Smooth Muscle, Actin Vascular Smooth Muscle, ACTSA, ACTVS, Alpha 2 Actin, Alpha Actin 2, Alpha Cardiac Actin, Alpha Smooth Muscle, Alpha-actin-2, Aortic Smooth Muscle, ASMA, Cell
MBS6123852-01 0.1 mL

Actin, Smooth Muscle (ACTA2, Actin Alpha 2 Smooth Muscle Aorta, Actin Aortic Smooth Muscle, Actin Vascular Smooth Muscle, ACTSA, ACTVS, Alpha 2 Actin, Alpha Actin 2, Alpha Cardiac Actin, Alpha Smooth Muscle, Alpha-actin-2, Aortic Smooth Muscle, ASMA, Cell

Sign In for Pricing
View Details
Actin, Smooth Muscle (ACTA2, Actin Alpha 2 Smooth Muscle Aorta, Actin Aortic Smooth Muscle, Actin Vascular Smooth Muscle, ACTSA, ACTVS, Alpha 2 Actin, Alpha Actin 2, Alpha Cardiac Actin, Alpha Smooth Muscle, Alpha-actin-2, Aortic Smooth Muscle, ASMA, Cell
MBS6123852-02 5x 0.1 mL

Actin, Smooth Muscle (ACTA2, Actin Alpha 2 Smooth Muscle Aorta, Actin Aortic Smooth Muscle, Actin Vascular Smooth Muscle, ACTSA, ACTVS, Alpha 2 Actin, Alpha Actin 2, Alpha Cardiac Actin, Alpha Smooth Muscle, Alpha-actin-2, Aortic Smooth Muscle, ASMA, Cell

Sign In for Pricing
View Details
Goat Calcipressin-3 (RCAN3) ELISA Kit
MBS7233948-01 48 Well

Goat Calcipressin-3 (RCAN3) ELISA Kit

Sign In for Pricing
View Details
Goat Calcipressin-3 (RCAN3) ELISA Kit
MBS7233948-02 96 Well

Goat Calcipressin-3 (RCAN3) ELISA Kit

Sign In for Pricing
View Details
Goat Calcipressin-3 (RCAN3) ELISA Kit
MBS7233948-03 5x 96 Well

Goat Calcipressin-3 (RCAN3) ELISA Kit

Sign In for Pricing
View Details