Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP25-1 Recombinant Protein (Human)
RP067611 100 µg

KRTAP25-1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Mest (NM_001009617) Rat Tagged ORF Clone
RR208674 10 µg

Mest (NM_001009617) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Timmdc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7566905 3x 1.0 µg

Timmdc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human TBC1D30 Knockout HEK293T cell line
GTR15412751 1 Vial

Human TBC1D30 Knockout HEK293T cell line

Sign In for Pricing
View Details
CD18 / ITGB2 Monoclonal Antibody
ANT-10858-100ug 100 µg

CD18 / ITGB2 Monoclonal Antibody

Sign In for Pricing
View Details
Human AMICA1 siRNA
abx907385-01 15 nmol

Human AMICA1 siRNA

Sign In for Pricing
View Details