Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Human XPNPEP2  Monoclonal Antibody
MBS2544310-01 0.06 mL

Rabbit anti Human XPNPEP2  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human XPNPEP2  Monoclonal Antibody
MBS2544310-02 0.12 mL

Rabbit anti Human XPNPEP2  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human XPNPEP2  Monoclonal Antibody
MBS2544310-03 0.2 mL

Rabbit anti Human XPNPEP2  Monoclonal Antibody

Sign In for Pricing
View Details
Lactate Dehydrogenase, pan (LDH, Plasmodium Lactate Dehydrogenase, Malaria Pf/Pv) (MaxLight 405) discontinued
227051-ML405 100 µL

Lactate Dehydrogenase, pan (LDH, Plasmodium Lactate Dehydrogenase, Malaria Pf/Pv) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Goose Transmembrane Protein 63C (TMEM63C) ELISA Kit
MBS9904626 Inquire

Goose Transmembrane Protein 63C (TMEM63C) ELISA Kit

Sign In for Pricing
View Details
RASSF3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6078R-BF488-01 20 µL

RASSF3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details