Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36RN, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36RN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36rn-protein-mouse-his.html

Purity

95.0

Smiles

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) Q9QYY1 (M2-D156) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABARAP Protein (N-His, Human)
P504092 100 µg

GABARAP Protein (N-His, Human)

Sign In for Pricing
View Details
Kcnq2 (NM_001006679) Mouse Untagged Clone
MC208816 10 µg

Kcnq2 (NM_001006679) Mouse Untagged Clone

Sign In for Pricing
View Details
Rab14 (NM_053589) Rat Tagged ORF Clone Lentiviral Particle
RR201378L4V 200 µL

Rab14 (NM_053589) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Lepisosteus oculatus Cytochrome c oxidase subunit 2 (mt-co2), partial
MBS7055895 Inquire

Recombinant Lepisosteus oculatus Cytochrome c oxidase subunit 2 (mt-co2), partial

Sign In for Pricing
View Details
CNTFR/CNTFR-alpha, Recombinant, Human, His-Tag, Active discontinued
046758 100 µg

CNTFR/CNTFR-alpha, Recombinant, Human, His-Tag, Active discontinued

Sign In for Pricing
View Details
4-Bromo-2-fluorobenzoic Acid
161246 10 g

4-Bromo-2-fluorobenzoic Acid

Sign In for Pricing
View Details