Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free KGF-2/FGF-10, Human (His)

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. Animal-Free KGF-2/FGF-10 Protein, Human (His) is the recombinant human-derived animal-FreeKGF-2/FGF-10 protein, expressed by E. coli , with C-His, C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free KGF-2/FGF-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-kgf-2-fgf-10-protein-human-his.html

Purity

98.0

Smiles

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Molecular Formula

2255 (Gene_ID) O15520 (L40-S208) (Accession)

Molecular Weight

Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Glutathione S-Transferase pi 1/GSTP1 Antibody [DyLight 550]
NBP1-76857R 0.1 mL

Rabbit Polyclonal Glutathione S-Transferase pi 1/GSTP1 Antibody [DyLight 550]

Sign In for Pricing
View Details
ATP1B2 Human qPCR Primer Pair (NM_001678)
HP205496 200 Reactions

ATP1B2 Human qPCR Primer Pair (NM_001678)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD62L Antibody
JOT20238F 20Tests

PerCP/Cyanine5.5 Anti-Mouse CD62L Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal MALT1 Antibody (MT1/3159R) [DyLight 405]
NBP3-08825V 100 µL

Rabbit Monoclonal MALT1 Antibody (MT1/3159R) [DyLight 405]

Sign In for Pricing
View Details
ITGB1BP3 Antibody - middle region : HRP (ARP42714_P050-HRP)
ARP42714_P050-HRP 100 µL

ITGB1BP3 Antibody - middle region : HRP (ARP42714_P050-HRP)

Sign In for Pricing
View Details
CD54 (ICAM-1) Antibody
MBS8501045-01 0.1 mg

CD54 (ICAM-1) Antibody

Sign In for Pricing
View Details