Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human (181a.a, His)

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. FGF-12 Protein, Human (181a.a, His) is the recombinant human-derived FGF-12 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human (181a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human-181a-a-his.html

Purity

95.0

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-2 (M1-T181) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(2-ethylhexyl)adipate
TRC-B433810-250G 250 g

Bis(2-ethylhexyl)adipate

Sign In for Pricing
View Details
OR10T2 Antibody
8G505-AAT 50 µg

OR10T2 Antibody

Sign In for Pricing
View Details
Human Apc11 (ANAPC11) activation kit by CRISPRa
GA109855 1 Kit

Human Apc11 (ANAPC11) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human DPEP2 Protein (Fc Tag)
PKSH030555 100 µg

Recombinant Human DPEP2 Protein (Fc Tag)

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF568 conjugate, 0.1mg/mL
BNC683648-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COMMD7 (NM_001099339) Human Over-expression Lysate
LY420436 100 µg

COMMD7 (NM_001099339) Human Over-expression Lysate

Sign In for Pricing
View Details