Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human (181a.a, His)

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. FGF-12 Protein, Human (181a.a, His) is the recombinant human-derived FGF-12 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human (181a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human-181a-a-his.html

Purity

95.0

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-2 (M1-T181) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRLHR Antibody
8G728-AAT 50 µg

PRLHR Antibody

Sign In for Pricing
View Details
Von Hippel Lindau (VHL) Human Gene Knockout Kit (CRISPR)
KN208875BN 1 Kit

Von Hippel Lindau (VHL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), 1mg/mL
BNUM1982-50 1x 50 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), 1mg/mL

Sign In for Pricing
View Details
Recombinant TRAF6 Antibody
RC-5426-01 50 μL

Recombinant TRAF6 Antibody

Sign In for Pricing
View Details
Recombinant TRAF6 Antibody
RC-5426-02 100 µL

Recombinant TRAF6 Antibody

Sign In for Pricing
View Details
Recombinant TRAF6 Antibody
RC-5426-03 1 mL

Recombinant TRAF6 Antibody

Sign In for Pricing
View Details