Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free NAP-2/CXCL7, Mouse (His)

NAP-2/CXCL7 proteins are members of the intercrine alpha family and are associated with chemokines that regulate intercellular communication and immune responses. As part of this family, NAP-2/CXCL7 may regulate inflammatory processes and cellular interactions. Animal-Free NAP-2/CXCL7 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free NAP-2/CXCL7 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-nap-2-cxcl7-protein-mouse-his.html

Purity

95.00

Smiles

KSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY

Molecular Formula

57349 (Gene_ID) Q9EQI5 (K40-Y113) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1B1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0067407 1.0 µg DNA

AKR1B1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), 0.2mg/mL
BNUB2951-500 1x 500 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), 0.2mg/mL

Sign In for Pricing
View Details
BAI3 (ADGRB3) (NM_001704) Human Untagged Clone
SC119090 10 µg

BAI3 (ADGRB3) (NM_001704) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal IL6R Antibody (B-N12) [PE]
NBP3-14598PE 0.1 mL

Mouse Monoclonal IL6R Antibody (B-N12) [PE]

Sign In for Pricing
View Details
C1orf173 Rabbit Polyclonal Antibody (Cy5.5)
orb1058241 100 µL

C1orf173 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Varicella Zoster Virus, Ellen Strain (VZV, VZVgE, VZVgI, Envelope Glycoprotein gI, GI, Glycoprotein IV, GPIV, Human Herpes Virus 3, Human Herpes virus 3, HHV3, Membrane Glycoprotein gE) (MaxLight 490) discontinued
V2100-26E-ML490 100 µL

Varicella Zoster Virus, Ellen Strain (VZV, VZVgE, VZVgI, Envelope Glycoprotein gI, GI, Glycoprotein IV, GPIV, Human Herpes Virus 3, Human Herpes virus 3, HHV3, Membrane Glycoprotein gE) (MaxLight 490) discontinued

Sign In for Pricing
View Details