Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIG/CXCL9, Human (HEK293, His)

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis[1][2]. MIG/CXCL9 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 103 amino acids (T23-T125) .

Product Specifications

Product Name Alternative

MIG/CXCL9 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mig-cxcl9-protein-human-hek-293-his.html

Purity

98.0

Smiles

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Molecular Formula

4283 (Gene_ID) Q07325 (T23-T125) (Accession)

Molecular Weight

Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Qiang Ding, et al. CXCL9: evidence and contradictions for its role in tumor progression. Cancer Med. 2016 Nov;5 (11) :3246-3259.|[2]Weigang Xiu, et al. CXCL9 secreted by tumor-associated dendritic cells up-regulates PD-L1 expression in bladder cancer cells by activating the CXCR3 signaling. BMC Immunol. 2021 Jan 6;22 (1) :3.|[3]Chao-Feng Lin, et al. Potential Effects of CXCL9 and CCL20 on Cardiac Fibrosis in Patients with Myocardial Infarction and Isoproterenol-Treated Rats. J Clin Med. 2019 May 11;8 (5) :659.|[4]Hui-Feng Gao, et al. CXCL9 chemokine promotes the progression of human pancreatic adenocarcinoma through STAT3-dependent cytotoxic T lymphocyte suppression. Aging (Albany NY) . 2020 Jan 8;12 (1) :502-517.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-500 1x 500 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF740 conjugate, 0.1mg/mL
BNC741099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), CF740 conjugate, 0.1mg/mL
BNC742951-500 1x 500 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL
BNC400640-100 1x 100 µL

CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details