Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMYD2, Human (sf9, His)

The SMYD2 protein is a multifunctional methyltransferase that can modify histones and non-histone proteins, including p53/TP53 and RB1. Notably, it trimethylates H3 at "Lys-4" (H3K4me3), which is critical for gene activation. SMYD2 Protein, Human (sf9, His) is the recombinant human-derived SMYD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Product Specifications

Product Name Alternative

SMYD2 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smyd2-protein-human-sf9-his.html

Purity

97.0

Smiles

MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH

Molecular Formula

56950 (Gene_ID) Q9NRG4-1 (M1-H433) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP4 (Fatty Acid Binding Protein 4, Adipocyte, A-FABP, aP2) (MaxLight 650)
MBS6227461-01 0.1 mL

FABP4 (Fatty Acid Binding Protein 4, Adipocyte, A-FABP, aP2) (MaxLight 650)

Sign In for Pricing
View Details
FABP4 (Fatty Acid Binding Protein 4, Adipocyte, A-FABP, aP2) (MaxLight 650)
MBS6227461-02 5x 0.1 mL

FABP4 (Fatty Acid Binding Protein 4, Adipocyte, A-FABP, aP2) (MaxLight 650)

Sign In for Pricing
View Details
Paddle stirrer PTFE-coated, stirrer diameter 70 mm, shaft diameter 6 mm, length 350 mm
RSO-E 22 1 Each

Paddle stirrer PTFE-coated, stirrer diameter 70 mm, shaft diameter 6 mm, length 350 mm

Sign In for Pricing
View Details
Rit1 Recombinant Protein (Mouse)
RP168305 100 µg

Rit1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Olr1705 AAV Vector (Rat) (CMV)
34156106 1 µg

Olr1705 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Rat Cdhr5 Pre-designed siRNA Set A
SI202421A 1 Each

Rat Cdhr5 Pre-designed siRNA Set A

Sign In for Pricing
View Details