Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD70 antigen (CD70), partial (Active)

Product Specifications

Product Name Alternative

(CD27 ligand) (CD27-L) (CD27L) (CD27LG) (TNFSF7)

Abbreviation

Recombinant Human CD70 protein, partial (Active)

Gene Name

CD70

UniProt

P32970

Expression Region

52-193aa

Organism

Homo sapiens (Human)

Target Sequence

SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Tag

N-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.7 kDa

References & Citations

"A clinicopathological study on the expression of cadherin-17 and caudal-related homeobox transcription factor (CDX2) in human gastric carcinoma." Ge J., Chen Z., Wu S., Yuan W., Hu B., Chen Z. Clin Oncol (R Coll Radiol) 20:275-283 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLE2, CT (TLE2, Transducin-like enhancer protein 2, Enhancer of split groucho-like protein 2) (MaxLight 490) discontinued
042867-ML490 100 µL

TLE2, CT (TLE2, Transducin-like enhancer protein 2, Enhancer of split groucho-like protein 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
HNF1AAntibody (Ascites) [AMM22140G]
AMM22140G-01 50 µL

HNF1AAntibody (Ascites) [AMM22140G]

Sign In for Pricing
View Details
HNF1AAntibody (Ascites) [AMM22140G]
AMM22140G-02 100 µL

HNF1AAntibody (Ascites) [AMM22140G]

Sign In for Pricing
View Details
HNF1AAntibody (Ascites) [AMM22140G]
AMM22140G-03 200 µL

HNF1AAntibody (Ascites) [AMM22140G]

Sign In for Pricing
View Details
HNF1AAntibody (Ascites) [AMM22140G]
AMM22140G-04 400 µL

HNF1AAntibody (Ascites) [AMM22140G]

Sign In for Pricing
View Details
Spry1 (D9V6P) Rabbit Monoclonal Antibody
CST 13013T 20 µL

Spry1 (D9V6P) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details