Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFCAB6 3'UTR Luciferase Stable Cell Line
TU006640 1.0 mL

EFCAB6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human NAP-2/ PPBP/ CXCL7 Protein, GST, E.coli-500ug
QP8641-ec-500ug 500ug

Recombinant Human NAP-2/ PPBP/ CXCL7 Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit
MBS451914-01 48 Tests

Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit

Sign In for Pricing
View Details
Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit
MBS451914-02 96 Tests

Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit

Sign In for Pricing
View Details
Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit
MBS451914-03 5x 96 Tests

Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit

Sign In for Pricing
View Details
Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit
MBS451914-04 10x 96 Tests

Bovine Eosinophil Chemotactic Factor (ECF) ELISA Kit

Sign In for Pricing
View Details