Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ATP5MF shRNA (UAS) - Lentiviral human ATP5MF shRNA (UAS, GFP) (25)
GTR15312983 1 Vial

Lentiviral human ATP5MF shRNA (UAS) - Lentiviral human ATP5MF shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
HIST1H1A (Histone H1.1, Histone H1a, H1F1) (MaxLight 405) discontinued
127875-ML405 100 µL

HIST1H1A (Histone H1.1, Histone H1a, H1F1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PSORS9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
38039061 1.0 µg DNA

PSORS9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MRPS10 Protein Vector (Mouse) (pPB-C-His)
PV202154 500 ng

MRPS10 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
RAB28 siRNA (Human)
MBS8215052-01 15 nmol

RAB28 siRNA (Human)

Sign In for Pricing
View Details
RAB28 siRNA (Human)
MBS8215052-02 30 nmol

RAB28 siRNA (Human)

Sign In for Pricing
View Details