Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-9 (ICE-LAP6, McL6, Apaf-3) (MaxLight 550) discontinued
214560-ML550 100 µL

Caspase-9 (ICE-LAP6, McL6, Apaf-3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ID3 Mouse Monoclonal Antibody [Clone ID: LBI5C7]
AMM09362VCF 100 µg

ID3 Mouse Monoclonal Antibody [Clone ID: LBI5C7]

Sign In for Pricing
View Details
SETDB1 sgRNA CRISPR Lentivector set (Human)
K2128801 3x 1.0 µg

SETDB1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mesothelin (MSLN) (NM_013404) Human Tagged Lenti ORF Clone
RC219757L1 10 µg

Mesothelin (MSLN) (NM_013404) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AMZ2 shRNA Plasmid (h)
sc-94228-SH 20 µg

AMZ2 shRNA Plasmid (h)

Sign In for Pricing
View Details
Monkey C-terminal telopeptide ELISA Kit
MBS7280581-01 48 Well

Monkey C-terminal telopeptide ELISA Kit

Sign In for Pricing
View Details