Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBP5 (TCEAL9) (NM_016303) Human Mass Spec Standard
PH312064 10 µg

WBP5 (TCEAL9) (NM_016303) Human Mass Spec Standard

Sign In for Pricing
View Details
MTREX Rabbit Polyclonal Antibody
TA361590 100 µL

MTREX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ulex europaeus Lectin (UEA II) - Pure
21560049-2 5mg

Ulex europaeus Lectin (UEA II) - Pure

Sign In for Pricing
View Details
Rabbit anti-Drosophila simulans (Fruit fly) EIF3B Polyclonal Antibody
MBS7138974 Inquire

Rabbit anti-Drosophila simulans (Fruit fly) EIF3B Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Flag Tag Antibody-Biotin (3S989)
MF-0074889 40 µg

Anti-Flag Tag Antibody-Biotin (3S989)

Sign In for Pricing
View Details
ZG16B (LOC124220, Zymogen Granule Protein 16 Homolog B, UNQ773/PRO1567) (MaxLight 750) discontinued
129155-ML750 100 µL

ZG16B (LOC124220, Zymogen Granule Protein 16 Homolog B, UNQ773/PRO1567) (MaxLight 750) discontinued

Sign In for Pricing
View Details