Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal L-Selectin/CD62L Antibody (FMC46) [PE/Cy7]
NB100-65388PECY7 0.1 mL

Mouse Monoclonal L-Selectin/CD62L Antibody (FMC46) [PE/Cy7]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SE11) hisS Polyclonal Antibody
MBS7172582 Inquire

Rabbit anti-Escherichia coli (strain SE11) hisS Polyclonal Antibody

Sign In for Pricing
View Details
Protease Inhibitor 15 Peptide
DF13876-BP 1 mg

Protease Inhibitor 15 Peptide

Sign In for Pricing
View Details
CRTC2, NT (CRTC2, TORC2, CREB-regulated transcription coactivator 2, Transducer of regulated cAMP response element-binding protein 2) (Azide free) (HRP) discontinued
034247-HRP 200 µL

CRTC2, NT (CRTC2, TORC2, CREB-regulated transcription coactivator 2, Transducer of regulated cAMP response element-binding protein 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal SLC14A1 Antibody (888418) [PE/Atto594]
FAB8238PEATT594 0.1 mL

Mouse Monoclonal SLC14A1 Antibody (888418) [PE/Atto594]

Sign In for Pricing
View Details
Human ACOT7 siRNA
abx900123-01 15 nmol

Human ACOT7 siRNA

Sign In for Pricing
View Details