Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SDAD1 activation kit by CRISPRa
GA110558 1 Kit

Human SDAD1 activation kit by CRISPRa

Sign In for Pricing
View Details
FFPE Tissue Blocks, Stomach
CB812610 1 Block

FFPE Tissue Blocks, Stomach

Sign In for Pricing
View Details
SCAP, NT (SCAP, KIAA0199, Sterol regulatory element-binding protein cleavage-activating protein) (MaxLight 750) discontinued
041448-ML750 100 µL

SCAP, NT (SCAP, KIAA0199, Sterol regulatory element-binding protein cleavage-activating protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Ttc13 3'UTR GFP Stable Cell Line
TU171282 1.0 mL

Ttc13 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DNAJC10 3'UTR Luciferase Stable Cell Line
TU006151 1.0 mL

DNAJC10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Txndc15 shRNA (UAS) - Lentiviral mouse Txndc15 shRNA (UAS) (25)
GTR15286553 1 Vial

Lentiviral mouse Txndc15 shRNA (UAS) - Lentiviral mouse Txndc15 shRNA (UAS) (25)

Sign In for Pricing
View Details