Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERN1 Knockout T47D Polyclonal Cells
ARG11959 1 Million

ERN1 Knockout T47D Polyclonal Cells

Sign In for Pricing
View Details
PDPK1, phosphorylated Ser396 (3-phosphoinositide Dependent Protein Kinase-1, hPDK1, PDK1) (PE) discontinued
P3123-02F-PE 200 µL

PDPK1, phosphorylated Ser396 (3-phosphoinositide Dependent Protein Kinase-1, hPDK1, PDK1) (PE) discontinued

Sign In for Pricing
View Details
Pcdhb2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6105502 1.0 µg DNA

Pcdhb2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
moc-5 Antibody
MBS7192249 Inquire

moc-5 Antibody

Sign In for Pricing
View Details
Bcl-2 monoclonal Antibody, Cy5 Conjugated
bsm-33413M-Cy5 100 µL

Bcl-2 monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
ALK-IN-26
M37104-01 1 g

ALK-IN-26

Sign In for Pricing
View Details