Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat MEF2A Protein, His (Fc)-Avi-tagged
MEF2A-3296R 50 µg

Recombinant Rat MEF2A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Biotinylated Anti-Murine KC Rabbit Polyclonal Antibody
TA328526 50 µg

Biotinylated Anti-Murine KC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) - AF750
MBS8325929-01 0.1 mL

Goat Anti-Chicken IgG (H&L) - AF750

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) - AF750
MBS8325929-02 0.5 mL

Goat Anti-Chicken IgG (H&L) - AF750

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) - AF750
MBS8325929-03 1 mL

Goat Anti-Chicken IgG (H&L) - AF750

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) - AF750
MBS8325929-04 5x 1 mL

Goat Anti-Chicken IgG (H&L) - AF750

Sign In for Pricing
View Details