Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Annexin V (ANX-V) ELISA Kit
NSL1820Bo 96 Tests

Bovine Annexin V (ANX-V) ELISA Kit

Sign In for Pricing
View Details
PAI (Plasminogen Activator Inhibitor) Rat ELISA Kit
F6596 96 Tests

PAI (Plasminogen Activator Inhibitor) Rat ELISA Kit

Sign In for Pricing
View Details
Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)
MF-0132042-01 5 µg

Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)

Sign In for Pricing
View Details
Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)
MF-0132042-02 10 µg

Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)

Sign In for Pricing
View Details
Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)
MF-0132042-03 20 µg

Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)

Sign In for Pricing
View Details
Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)
MF-0132042-04 50 µg

Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein/GP-RBD (Receptor Binding Domain) Protein (hFc)

Sign In for Pricing
View Details