Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKA1 Polyclonal Antibody, PerCP Conjugated
bs-7846R-PerCP 100 µL

SKA1 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Anti-ERBB1/EGFR/HER1 Antibody (Pimurutamab)
F1425-50 50 mg

Anti-ERBB1/EGFR/HER1 Antibody (Pimurutamab)

Sign In for Pricing
View Details
Mouse Monoclonal CTCF Antibody (CL0307)
NBP2-52911-25ul 25 µL

Mouse Monoclonal CTCF Antibody (CL0307)

Sign In for Pricing
View Details
Ccp110 Protein Vector (Rat) (pPB-N-His)
PV258355 500 ng

Ccp110 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
LEPROT Protein Vector (Mouse) (pPM-C-His)
PV196373 500 ng

LEPROT Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Developmental pluripotency associated 2
313391 100 µL

Developmental pluripotency associated 2

Sign In for Pricing
View Details