Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pdk3 shRNA (UAS) - Lentiviral mouse Pdk3 shRNA (UAS, GFP) plasmid
GTR15250510 1 Vial

Lentiviral mouse Pdk3 shRNA (UAS) - Lentiviral mouse Pdk3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Zbtb18 (NM_001012330) Mouse Tagged Lenti ORF Clone
MR219443L3 10 µg

Zbtb18 (NM_001012330) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C2orf62 Protein Vector (Human) (pPB-N-His)
PV006258 500 ng

C2orf62 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Canine Epidermal growth factor (EGF) ELISA Kit
YP-W76169-01 48 Tests

Canine Epidermal growth factor (EGF) ELISA Kit

Sign In for Pricing
View Details
Canine Epidermal growth factor (EGF) ELISA Kit
YP-W76169-02 96 Tests

Canine Epidermal growth factor (EGF) ELISA Kit

Sign In for Pricing
View Details
Tmem183a sgRNA CRISPR Lentivector set (Mouse)
K4867001 3x 1.0 µg

Tmem183a sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details