Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-his.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

95-150 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SOS1 Antibody (SOS-01) [Janelia Fluor 646]
NB110-68800JF646 0.1 mL

Mouse Monoclonal SOS1 Antibody (SOS-01) [Janelia Fluor 646]

Sign In for Pricing
View Details
Coiled Coil Domain Containing Protein 99 (CCDC99) BioAssayTM ELISA Kit (Human)
589124 96 Tests

Coiled Coil Domain Containing Protein 99 (CCDC99) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal CD302/CLEC13A Antibody (071) [mFluor Violet 500 SE]
NBP2-90687MFV500 0.1 mL

Rabbit Monoclonal CD302/CLEC13A Antibody (071) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Receptor Expression-Enhancing Protein 1/2 (REEP1/2) Antibody (ATTO 700)
abx442207 100 µg

Receptor Expression-Enhancing Protein 1/2 (REEP1/2) Antibody (ATTO 700)

Sign In for Pricing
View Details
Rat DUSP1 (Dual Specificity Phosphatase 1) ELISA Kit
ELK0878-01 48 Tests

Rat DUSP1 (Dual Specificity Phosphatase 1) ELISA Kit

Sign In for Pricing
View Details
Rat DUSP1 (Dual Specificity Phosphatase 1) ELISA Kit
ELK0878-02 96 Tests

Rat DUSP1 (Dual Specificity Phosphatase 1) ELISA Kit

Sign In for Pricing
View Details