Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor receptor superfamily member 14 (Tnfrsf14), partial (Active)

Product Specifications

Product Name Alternative

Tnfrsf14; Herpesvirus entry mediator; HVEM; TR2; TNF receptor-like molecule; ATAR; another TRAF-associated receptor; Tumor necrosis factor receptor superfamily member 14

Abbreviation

Recombinant Mouse Tnfrsf14 protein, partial (Active)

Gene Name

Tnfrsf14

UniProt

Q80WM9

Expression Region

39-207aa

Organism

Mus musculus (Mouse)

Target Sequence

QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

Tag

C-terminal Fc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF8 antibody
FNab07362 100 µg

RNF8 antibody

Sign In for Pricing
View Details
NY-ESO-1 (MaxLight 650)
MBS6259875-01 0.1 mL

NY-ESO-1 (MaxLight 650)

Sign In for Pricing
View Details
NY-ESO-1 (MaxLight 650)
MBS6259875-02 5x 0.1 mL

NY-ESO-1 (MaxLight 650)

Sign In for Pricing
View Details
HPLC Column, C18-Universal,5μm,120Å,3.9x150mm
13011161 1 PC

HPLC Column, C18-Universal,5μm,120Å,3.9x150mm

Sign In for Pricing
View Details
Pipet Tips, Vol. 5000 u l,
CG311-1X500NO 1 unit

Pipet Tips, Vol. 5000 u l,

Sign In for Pricing
View Details
PFKP Protein (N-GST & His, Human)
P527533 100 µg

PFKP Protein (N-GST & His, Human)

Sign In for Pricing
View Details