Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Podoplanin, Mouse (HEK293, Fc)

Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Podoplanin protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Podoplanin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/podoplanin-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK

Molecular Formula

14726 (Gene_ID) Q62011 (G23-K133) (Accession)

Molecular Weight

55-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF640R conjugate, 0.1mg/mL
BNC401951-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL
BNC042873-100 1x 100 µL

CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL
BNC681893-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF568 conjugate, 0.1mg/mL
BNC682786-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL
BNC682075-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details