Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Podoplanin, Mouse (HEK293, Fc)

Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Podoplanin protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Podoplanin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/podoplanin-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK

Molecular Formula

14726 (Gene_ID) Q62011 (G23-K133) (Accession)

Molecular Weight

55-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cenpj ORF Vector (Rat) (pORF)
ORF064848 1.0 µg DNA

Cenpj ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: LBI4E1]
AMM20039VCF 100 µg

CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: LBI4E1]

Sign In for Pricing
View Details
Human IL-13 Antibody
OASB01229-500UG 0.5 mg

Human IL-13 Antibody

Sign In for Pricing
View Details
Recombinant Shewanella sp. DNA mismatch repair protein MutS (mutS), partial
MBS1408005 Inquire

Recombinant Shewanella sp. DNA mismatch repair protein MutS (mutS), partial

Sign In for Pricing
View Details
Human RAP1B (Ras-Related Protein Rap-1b) ELISA Kit
MBS7607901-01 48 Well

Human RAP1B (Ras-Related Protein Rap-1b) ELISA Kit

Sign In for Pricing
View Details
Human RAP1B (Ras-Related Protein Rap-1b) ELISA Kit
MBS7607901-02 96 Well

Human RAP1B (Ras-Related Protein Rap-1b) ELISA Kit

Sign In for Pricing
View Details