Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Allograft inflammatory factor 1 (AIF1)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Bovine AIF1 protein

Gene Name

AIF1

UniProt

Q9BDK2

Expression Region

2-147aa

Organism

Bos taurus (Bovine)

Target Sequence

SETRDLQGGKAFGLRKAQQEERINEINQQFLDDPKYSSDEDLPSKLEAFKKKYMEFDLNEDGGIDIMSLKRMMEKLGVPKTHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKMILMYEEKAREQEKPTGLPAKKAISELP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in macrophage activation and function.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.6 kDa

References & Citations

"Increased messenger RNA for allograft inflammatory factor-1, LERK-5, and a novel gene in 17.5-day relative to 15.5-day bovine embryos." Glover M.D., Seidel G.E. Jr. Biol. Reprod. 69:1002-1012 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK5RAP3 Rabbit Polyclonal Antibody
ER1902-72 100 µL

CDK5RAP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MS4A4E activation kit by CRISPRa
GA118702 1 Kit

Human MS4A4E activation kit by CRISPRa

Sign In for Pricing
View Details
CD79a (JCB117), CF568 conjugate, 0.1mg/mL
BNC680476-500 1x 500 µL

CD79a (JCB117), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dihydro Capsaicin-d3
TRC-D448752-1MG 1 mg

Dihydro Capsaicin-d3

Sign In for Pricing
View Details
C1orf227 (SPATA45) (NM_001024601) Human Over-expression Lysate
LC422517 20 µg

C1orf227 (SPATA45) (NM_001024601) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DUXB activation kit by CRISPRa
GA119062 1 Kit

Human DUXB activation kit by CRISPRa

Sign In for Pricing
View Details