Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF120, Mouse

VEGF-A Protein is a key member of the VEGF family of cytokines.VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability.VEGF-A stimulates endothelial cell mitogenesis and cell migration.VEGF120 Protein, Mouse is the recombinant mouse-derived VEGF120 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

VEGF120 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf120-protein-mouse.html

Purity

96.00

Smiles

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

Molecular Formula

22339 (Gene_ID) Q00731-3 (A27-R146) (Accession)

Molecular Weight

Approximately 17 kDa under reduced (R) conditions, 36 kDa under non reducing (N) conditions, based on SDS-PAGE.

References & Citations

[1]He W, et al. CMT2D neuropathy is linked to the neomorphic binding activity of glycyl-tRNA synthetase. Nature. 2015 Oct 29;526 (7575) :710-4.|[2]Herrera VL, et al. Embryonic lethality in Dear gene-deficient mice: new player in angiogenesis. Physiol Genomics. 2005 Nov 17;23 (3) :257-68.|[3]Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25 (1) :1-19.|[4]Murphy JF, et al. Vascular endothelial growth factor induces cyclooxygenase-dependent proliferation of endothelial cells via the VEGF-2 receptor. FASEB J. 2001 Jul;15 (9) :1667-9.|[5]Dixelius J, et al. Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein. Cancer Res. 2006 Feb 15;66 (4) :2089-97.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pafah1b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7093006 1.0 µg DNA

Pafah1b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
INTS10 Rabbit Polyclonal Antibody
orb1545960-01 50 μL

INTS10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
INTS10 Rabbit Polyclonal Antibody
orb1545960-02 100 µL

INTS10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Phenylbutan-2-Ol
RG-P080528-01 10 mg

2-Phenylbutan-2-Ol

Sign In for Pricing
View Details
2-Phenylbutan-2-Ol
RG-P080528-02 25 mg

2-Phenylbutan-2-Ol

Sign In for Pricing
View Details
2-Phenylbutan-2-Ol
RG-P080528-03 50 mg

2-Phenylbutan-2-Ol

Sign In for Pricing
View Details