Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ham's F-12 (Kaighn's Modification) With L-glutamine
HFL06-6X500ML 6x 500 mL

Ham's F-12 (Kaighn's Modification) With L-glutamine

Sign In for Pricing
View Details
Anti-Serotonin Receptor 3B / HTR3B antibody
STJ71971 100 µg

Anti-Serotonin Receptor 3B / HTR3B antibody

Sign In for Pricing
View Details
Trim12a AAV siRNA Pooled Vector
47745164 1.0 µg

Trim12a AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (Biotin)
MBS6143425-01 0.1 mL

PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (Biotin)

Sign In for Pricing
View Details
PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (Biotin)
MBS6143425-02 5x 0.1 mL

PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (Biotin)

Sign In for Pricing
View Details
DGKG (NM_001080744) Human Tagged Lenti ORF Clone
RC224710L4 10 µg

DGKG (NM_001080744) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details