Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B6 sgRNA CRISPR Lentivector set (Human)
K0993601 3x 1.0 µg

HSD17B6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal KIR2DL1/CD158a Antibody (HP-MA4) [mFluor Violet 610 SE]
NBP2-62191MFV610 0.1 mL

Mouse Monoclonal KIR2DL1/CD158a Antibody (HP-MA4) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
anti-HGD
YF-PA23874 50 ul

anti-HGD

Sign In for Pricing
View Details
PRL Protein Vector (Mouse) (pPB-N-His)
PV219363 500 ng

PRL Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Tox3 Mouse Pre-designed siRNA Set A
HY-RS22349 1 Set

Tox3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human anti-Cha f 1 IgE
E4A11B99-E 50 µg

Human anti-Cha f 1 IgE

Sign In for Pricing
View Details