Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIT1 Human Recombinant Protein
TP725236 50 µg

TRIT1 Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal ALCAM/CD166 Antibody (105902) [Allophycocyanin]
FAB6561A 0.1 mL

Mouse Monoclonal ALCAM/CD166 Antibody (105902) [Allophycocyanin]

Sign In for Pricing
View Details
DGCR8 (Microprocessor Complex Subunit DGCR8, DiGeorge Syndrome Critical Region 8, C22orf12, DGCRK6, LP4941) (MaxLight 650)
MBS6376070-01 0.1 mL

DGCR8 (Microprocessor Complex Subunit DGCR8, DiGeorge Syndrome Critical Region 8, C22orf12, DGCRK6, LP4941) (MaxLight 650)

Sign In for Pricing
View Details
DGCR8 (Microprocessor Complex Subunit DGCR8, DiGeorge Syndrome Critical Region 8, C22orf12, DGCRK6, LP4941) (MaxLight 650)
MBS6376070-02 5x 0.1 mL

DGCR8 (Microprocessor Complex Subunit DGCR8, DiGeorge Syndrome Critical Region 8, C22orf12, DGCRK6, LP4941) (MaxLight 650)

Sign In for Pricing
View Details
IFNAR1 antibody
70R-51564 100 ul

IFNAR1 antibody

Sign In for Pricing
View Details
Recombinant Enterobacter sp. Ribosome maturation factor RimM (rimM)
MBS1207254-01 0.02 mg (E-Coli)

Recombinant Enterobacter sp. Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details