Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-[ (3S) -1,2-Dithiolan-3-yl]pentanoyl-CoA
MF-0059794-01 10 mg

5-[ (3S) -1,2-Dithiolan-3-yl]pentanoyl-CoA

Sign In for Pricing
View Details
5-[ (3S) -1,2-Dithiolan-3-yl]pentanoyl-CoA
MF-0059794-02 50 mg

5-[ (3S) -1,2-Dithiolan-3-yl]pentanoyl-CoA

Sign In for Pricing
View Details
GAN sgRNA CRISPR Lentivector (Human) (Target 3)
K0837704 1.0 µg DNA

GAN sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Vwa8 shRNA (UAS) - Lentiviral mouse Vwa8 shRNA (UAS, GFP) (100)
GTR15282057 1 Vial

Lentiviral mouse Vwa8 shRNA (UAS) - Lentiviral mouse Vwa8 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Caspase-2 Fluorometric Assay Kit - 400 assays
GWB-AXR051 400 Assays

Caspase-2 Fluorometric Assay Kit - 400 assays

Sign In for Pricing
View Details
mmu-miR-297c miRNA Antagomir
MNM01619 2x 5.0 nmol

mmu-miR-297c miRNA Antagomir

Sign In for Pricing
View Details