Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroplakin 3B Antibody / UPK3B
V4628-100UG 100 µg

Uroplakin 3B Antibody / UPK3B

Sign In for Pricing
View Details
CACNG5 (NM_145811) Human Tagged ORF Clone Lentiviral Particle
RC210953L3V 200 µL

CACNG5 (NM_145811) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DLGAP4, NT (DLGAP4, DAP4, KIAA0964, SAPAP4, Disks large-associated protein 4, PSD-95/SAP90-binding protein 4, SAP90/PSD-95-associated protein 4) (MaxLight 550)
MBS6292340-01 0.1 mL

DLGAP4, NT (DLGAP4, DAP4, KIAA0964, SAPAP4, Disks large-associated protein 4, PSD-95/SAP90-binding protein 4, SAP90/PSD-95-associated protein 4) (MaxLight 550)

Sign In for Pricing
View Details
DLGAP4, NT (DLGAP4, DAP4, KIAA0964, SAPAP4, Disks large-associated protein 4, PSD-95/SAP90-binding protein 4, SAP90/PSD-95-associated protein 4) (MaxLight 550)
MBS6292340-02 5x 0.1 mL

DLGAP4, NT (DLGAP4, DAP4, KIAA0964, SAPAP4, Disks large-associated protein 4, PSD-95/SAP90-binding protein 4, SAP90/PSD-95-associated protein 4) (MaxLight 550)

Sign In for Pricing
View Details
RGD1310039 Protein Vector (Rat) (pPM-C-HA)
39089026 500 ng

RGD1310039 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Smad2/3 (Phospho Thr8) Polyclonal Antibody
BT-AP07998-01 20 µL

Smad2/3 (Phospho Thr8) Polyclonal Antibody

Sign In for Pricing
View Details