Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGL1 shRNA Plasmid (h)
sc-62453-SH 20 µg

FGL1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Setd2 3'UTR Lenti-reporter-Luc Vector
43522084 1.0 µg

Setd2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
BRS3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0196505 3x 1.0 µg

BRS3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase RBX1 Protein, GST, E.coli-50ug
QP6590-ec-50ug 50ug

Recombinant Human E3 ubiquitin-protein ligase RBX1 Protein, GST, E.coli-50ug

Sign In for Pricing
View Details
Chikungunya Wild Type E1
JBS-PR-1283 10 µg

Chikungunya Wild Type E1

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yraL (yraL)
MBS1020682-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein yraL (yraL)

Sign In for Pricing
View Details