Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monascin
MF-0022980-01 500 µg

Monascin

Sign In for Pricing
View Details
Monascin
MF-0022980-02 1 mg

Monascin

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae Uncharacterized membrane protein in cps region Protein (aa 1-485)
VAng-Cr5515-inquire Inquire

Recombinant Klebsiella Pneumoniae Uncharacterized membrane protein in cps region Protein (aa 1-485)

Sign In for Pricing
View Details
N-Methyl-N-[3-[[[ (8β) -6- (2-propen-1-yl) ergolin-8-yl]carbonyl]amino]propyl]carbamic Acid 1,1-Dimethylethyl Ester
459452-01 1 mg

N-Methyl-N-[3-[[[ (8β) -6- (2-propen-1-yl) ergolin-8-yl]carbonyl]amino]propyl]carbamic Acid 1,1-Dimethylethyl Ester

Sign In for Pricing
View Details
N-Methyl-N-[3-[[[ (8β) -6- (2-propen-1-yl) ergolin-8-yl]carbonyl]amino]propyl]carbamic Acid 1,1-Dimethylethyl Ester
459452-02 2.5 mg

N-Methyl-N-[3-[[[ (8β) -6- (2-propen-1-yl) ergolin-8-yl]carbonyl]amino]propyl]carbamic Acid 1,1-Dimethylethyl Ester

Sign In for Pricing
View Details
PD-1 Antibody (YA5617, Mouse)
HY-P85925-01 10 µL

PD-1 Antibody (YA5617, Mouse)

Sign In for Pricing
View Details