Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAB2B activation kit by CRISPRa
GA113777 1 Kit

Human RAB2B activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-C-Reactive Polyclonal Antibody
MF-0068372-01 50 µL

Anti-C-Reactive Polyclonal Antibody

Sign In for Pricing
View Details
Anti-C-Reactive Polyclonal Antibody
MF-0068372-02 100 µL

Anti-C-Reactive Polyclonal Antibody

Sign In for Pricing
View Details
Anti-C-Reactive Polyclonal Antibody
MF-0068372-03 200 µL

Anti-C-Reactive Polyclonal Antibody

Sign In for Pricing
View Details
CD33 (Myeloid Cell Surface Antigen CD33, Sialic Acid-binding Ig-like Lectin 3, Siglec 3, gp67, Siglec 3) (MaxLight 650)
MBS6373056-01 0.1 mL

CD33 (Myeloid Cell Surface Antigen CD33, Sialic Acid-binding Ig-like Lectin 3, Siglec 3, gp67, Siglec 3) (MaxLight 650)

Sign In for Pricing
View Details
CD33 (Myeloid Cell Surface Antigen CD33, Sialic Acid-binding Ig-like Lectin 3, Siglec 3, gp67, Siglec 3) (MaxLight 650)
MBS6373056-02 5x 0.1 mL

CD33 (Myeloid Cell Surface Antigen CD33, Sialic Acid-binding Ig-like Lectin 3, Siglec 3, gp67, Siglec 3) (MaxLight 650)

Sign In for Pricing
View Details