Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rap2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3800205 3x 1.0 µg

Rap2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PMS2 Recombinant Rabbit mAb,PBS Only (SDT-111-307)
S0B2237P-01 100 µg

PMS2 Recombinant Rabbit mAb,PBS Only (SDT-111-307)

Sign In for Pricing
View Details
PMS2 Recombinant Rabbit mAb,PBS Only (SDT-111-307)
S0B2237P-02 1 mg

PMS2 Recombinant Rabbit mAb,PBS Only (SDT-111-307)

Sign In for Pricing
View Details
PMS2 Recombinant Rabbit mAb,PBS Only (SDT-111-307)
S0B2237P-03 25 µg

PMS2 Recombinant Rabbit mAb,PBS Only (SDT-111-307)

Sign In for Pricing
View Details
CXCR2 (CD182, C-X-C Chemokine Receptor Type 2, CXC-R2, CXCR-2, CDw128b, GRO/MGSA Receptor, High Affinity Interleukin-8 Receptor B, IL-8R B, IL-8 Receptor Type 2, IL8RB) discontinued
C8348-04C 40 µg

CXCR2 (CD182, C-X-C Chemokine Receptor Type 2, CXC-R2, CXCR-2, CDw128b, GRO/MGSA Receptor, High Affinity Interleukin-8 Receptor B, IL-8R B, IL-8 Receptor Type 2, IL8RB) discontinued

Sign In for Pricing
View Details
Anti-Hu CD56 Purified
MBS1801105-01 0.1 mg

Anti-Hu CD56 Purified

Sign In for Pricing
View Details