Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Interleukin 17 (IL-17) ELISA Kit
MBS285947-01 48 Tests

Rabbit Interleukin 17 (IL-17) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 17 (IL-17) ELISA Kit
MBS285947-02 96 Tests

Rabbit Interleukin 17 (IL-17) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 17 (IL-17) ELISA Kit
MBS285947-03 5x 96 Tests

Rabbit Interleukin 17 (IL-17) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 17 (IL-17) ELISA Kit
MBS285947-04 10x 96 Tests

Rabbit Interleukin 17 (IL-17) ELISA Kit

Sign In for Pricing
View Details
Cadherin 8 (CDH8) (NM_001796) Human Over-expression Lysate
LS001006-100ug 100 µg

Cadherin 8 (CDH8) (NM_001796) Human Over-expression Lysate

Sign In for Pricing
View Details
IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (PE)
247515-PE 100 µL

IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (PE)

Sign In for Pricing
View Details