Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDPK1 (NM_031268) Human Over-expression Lysate
LY410607 100 µg

PDPK1 (NM_031268) Human Over-expression Lysate

Sign In for Pricing
View Details
DDX52 antibody
FNab02315 100 µg

DDX52 antibody

Sign In for Pricing
View Details
Anti-HLA-DRA/DRB4 (scFv-E6) (Mouse, Monoclonal, IgG1)
A131054 100 µL

Anti-HLA-DRA/DRB4 (scFv-E6) (Mouse, Monoclonal, IgG1)

Sign In for Pricing
View Details
granzyme F Double Nickase Plasmid (m)
sc-420749-NIC 20 µg

granzyme F Double Nickase Plasmid (m)

Sign In for Pricing
View Details
HOXB5 (Homeobox Protein Hox-B5, Homeobox Protein HHO.C10, HOX2A, Homeobox Protein Hox-2A, Homeobox Protein Hu-1) (MaxLight 405) discontinued
128022-ML405 100 µL

HOXB5 (Homeobox Protein Hox-B5, Homeobox Protein HHO.C10, HOX2A, Homeobox Protein Hox-2A, Homeobox Protein Hu-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
pOTB7-PMVK Plasmid
PVT24907 2 µg

pOTB7-PMVK Plasmid

Sign In for Pricing
View Details