Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Got1l1 Mouse shRNA Lentiviral Particle (Locus ID 76615)
TL514297V 500 µL Each

Got1l1 Mouse shRNA Lentiviral Particle (Locus ID 76615)

Sign In for Pricing
View Details
Brexpiprazole-d8
MF-0004746-01 1 mg

Brexpiprazole-d8

Sign In for Pricing
View Details
Brexpiprazole-d8
MF-0004746-02 5 mg

Brexpiprazole-d8

Sign In for Pricing
View Details
Rat Activin receptor type-2A ELISA Kit
MBS2880835-01 48 Well

Rat Activin receptor type-2A ELISA Kit

Sign In for Pricing
View Details
Rat Activin receptor type-2A ELISA Kit
MBS2880835-02 96 Well

Rat Activin receptor type-2A ELISA Kit

Sign In for Pricing
View Details
Rat Activin receptor type-2A ELISA Kit
MBS2880835-03 5x 96 Well

Rat Activin receptor type-2A ELISA Kit

Sign In for Pricing
View Details