Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Transcription factor IIIB 50 kDa subunit (BRF2) ELISA Kit
EIA06690p 1 Kit

Porcine Transcription factor IIIB 50 kDa subunit (BRF2) ELISA Kit

Sign In for Pricing
View Details
Hsf2bp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3676108 1.0 µg DNA

Hsf2bp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
PPP1R9B (Protein phosphatase 1 regulatory subunit 9B, Spn, SPINO, PPP1R6, PPP1R9) (HRP)
MBS6432627-01 0.1 mL

PPP1R9B (Protein phosphatase 1 regulatory subunit 9B, Spn, SPINO, PPP1R6, PPP1R9) (HRP)

Sign In for Pricing
View Details
PPP1R9B (Protein phosphatase 1 regulatory subunit 9B, Spn, SPINO, PPP1R6, PPP1R9) (HRP)
MBS6432627-02 5x 0.1 mL

PPP1R9B (Protein phosphatase 1 regulatory subunit 9B, Spn, SPINO, PPP1R6, PPP1R9) (HRP)

Sign In for Pricing
View Details
Papaverine hydrochloride
GP4713-5g 5 g

Papaverine hydrochloride

Sign In for Pricing
View Details
Mouse Transmembrane protein 26, Tmem26 ELISA KIT
ELI-16311m 96 Tests

Mouse Transmembrane protein 26, Tmem26 ELISA KIT

Sign In for Pricing
View Details