Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-conjugated Polyclonal Goat Anti-Mouse IgG (H+L) Secondary Antibody
APS0630-01 200 µL

Biotin-conjugated Polyclonal Goat Anti-Mouse IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Biotin-conjugated Polyclonal Goat Anti-Mouse IgG (H+L) Secondary Antibody
APS0630-02 500 µL

Biotin-conjugated Polyclonal Goat Anti-Mouse IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Anti-c-RAF Antibody
MBS9240684-01 0.05 mL

Anti-c-RAF Antibody

Sign In for Pricing
View Details
Anti-c-RAF Antibody
MBS9240684-02 0.1 mL

Anti-c-RAF Antibody

Sign In for Pricing
View Details
Anti-c-RAF Antibody
MBS9240684-03 5x 0.1 mL

Anti-c-RAF Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
UB-GEN-13007 100 µL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details