Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZRSR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV702647 1.0 µg DNA

ZRSR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Protein phosphatase 1M (PP2C domain containing)
330975 100 µL

Protein phosphatase 1M (PP2C domain containing)

Sign In for Pricing
View Details
MORN1 Protein Vector (Mouse) (pPB-C-His)
PV201570 500 ng

MORN1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
NDRG2, NT (NDRG2, KIAA1248, SYLD, Protein NDRG2, N-myc downstream-regulated gene 2 protein, Protein Syld709613) (MaxLight 550) discontinued
038847-ML550 100 µL

NDRG2, NT (NDRG2, KIAA1248, SYLD, Protein NDRG2, N-myc downstream-regulated gene 2 protein, Protein Syld709613) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lentiviral human XRN2 shRNA (UAS) - Lentiviral human XRN2 shRNA (UAS) (100)
GTR15329133 1 Vial

Lentiviral human XRN2 shRNA (UAS) - Lentiviral human XRN2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Guinea pig Guanylate nucleotide binding protein 4 ELISA Kit
MBS732447-01 48 Well

Guinea pig Guanylate nucleotide binding protein 4 ELISA Kit

Sign In for Pricing
View Details