Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL32 Antibody
A14433-50UG 50 µg

IL32 Antibody

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Arginine exporter protein ArgO (argO), partial
MBS7074582 Inquire

Recombinant Yersinia pestis bv. Antiqua Arginine exporter protein ArgO (argO), partial

Sign In for Pricing
View Details
HLA DMB Recombinant Antibody, HRP Conjugated
bsm-62489R-HRP 100 µL

HLA DMB Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Mouse Ndrg3 (NM_180956) AAV Particle
MR206063A1V 250 µL

Mouse Ndrg3 (NM_180956) AAV Particle

Sign In for Pricing
View Details
C8orf45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0260705 3x 1.0 µg

C8orf45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)
SIPB803Hu01-01 10 µg

Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)

Sign In for Pricing
View Details