Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Acetobutylicum ssb2 Protein (aa 1-133)
VAng-Lsx7864-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Acetobutylicum ssb2 Protein (aa 1-133)

Sign In for Pricing
View Details
Zfp444-set siRNA/shRNA/RNAi Lentivector (Rat)
50977096 4x 500 ng

Zfp444-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
PSME2 Human Recombinant Protein
TP725886 50 µg

PSME2 Human Recombinant Protein

Sign In for Pricing
View Details
BEN Domain-Containing Protein 5 (BEND5) Antibody
abx432098 200 µL

BEN Domain-Containing Protein 5 (BEND5) Antibody

Sign In for Pricing
View Details
Lentiviral human TRIOBP sgRNA gene knockout kit - Lentiviral human TRIOBP sgRNA gene knockout kit (25)
GTR15396879 1 Vial

Lentiviral human TRIOBP sgRNA gene knockout kit - Lentiviral human TRIOBP sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
CLPX Protein Vector (Human) (pPM-C-HA)
PV069931 500 ng

CLPX Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details