Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostate Specific Antigen (CT) (Kallikrein-3, kallikrein-related peptidase 3, APS, Gamma-seminoprotein, hK3, KLK2A1, P-30 antigen, Prostate-specific antigen, PSA, Semenogelase, Seminin) (MaxLight 490)
MBS6494797-01 0.1 mL

Prostate Specific Antigen (CT) (Kallikrein-3, kallikrein-related peptidase 3, APS, Gamma-seminoprotein, hK3, KLK2A1, P-30 antigen, Prostate-specific antigen, PSA, Semenogelase, Seminin) (MaxLight 490)

Sign In for Pricing
View Details
Prostate Specific Antigen (CT) (Kallikrein-3, kallikrein-related peptidase 3, APS, Gamma-seminoprotein, hK3, KLK2A1, P-30 antigen, Prostate-specific antigen, PSA, Semenogelase, Seminin) (MaxLight 490)
MBS6494797-02 5x 0.1 mL

Prostate Specific Antigen (CT) (Kallikrein-3, kallikrein-related peptidase 3, APS, Gamma-seminoprotein, hK3, KLK2A1, P-30 antigen, Prostate-specific antigen, PSA, Semenogelase, Seminin) (MaxLight 490)

Sign In for Pricing
View Details
MAP2K1 (Biotin)
568049-01 50 µg

MAP2K1 (Biotin)

Sign In for Pricing
View Details
MAP2K1 (Biotin)
568049-02 100 µg

MAP2K1 (Biotin)

Sign In for Pricing
View Details
Easypro Human Cytokeratin 19 (CK-19/KRT19) ELISA Kit
FY-EH2214S 96 Well

Easypro Human Cytokeratin 19 (CK-19/KRT19) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-acid glycoprotein 1 (ORM1) ELISA Kit
YP-W14877-01 48 Tests

Human Alpha-1-acid glycoprotein 1 (ORM1) ELISA Kit

Sign In for Pricing
View Details