Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPHK2 Monoclonal Antibody, APC-Cy5.5 Conjugated
bsm-33868M-APC-Cy5.5 100 µL

SPHK2 Monoclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
IFRD1 (NM_001550) Human Tagged Lenti ORF Clone
RC217538L4 10 µg

IFRD1 (NM_001550) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TNS4 Protein Lysate (Mouse) with C-HA Tag
47270034 100 µg

TNS4 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral mouse Pde6g shRNA (UAS) - Lentiviral mouse Pde6g shRNA (UAS, GFP) plasmid
GTR15233734 1 Vial

Lentiviral mouse Pde6g shRNA (UAS) - Lentiviral mouse Pde6g shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Fibrinogen (Coagulation Factor I) discontinued
F4203-02F 1 mL

Fibrinogen (Coagulation Factor I) discontinued

Sign In for Pricing
View Details
CTSL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0530008 1.0 µg DNA

CTSL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details