Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gsx1 3'UTR GFP Stable Cell Line
TU159193 1.0 mL

Gsx1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PDIA4 Antibody, Biotin conjugated
A30888-50UG 50 µg

PDIA4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GPR120 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8596R-BF750 100 µL

GPR120 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Porcine Anion exchange protein 2 (SLC4A2) ELISA Kit
MBS7247151-01 48 Well

Porcine Anion exchange protein 2 (SLC4A2) ELISA Kit

Sign In for Pricing
View Details
Porcine Anion exchange protein 2 (SLC4A2) ELISA Kit
MBS7247151-02 96 Well

Porcine Anion exchange protein 2 (SLC4A2) ELISA Kit

Sign In for Pricing
View Details
Porcine Anion exchange protein 2 (SLC4A2) ELISA Kit
MBS7247151-03 5x 96 Well

Porcine Anion exchange protein 2 (SLC4A2) ELISA Kit

Sign In for Pricing
View Details