Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-H (I104) polyclonal antibody
E43S3876 100 µL

HLA-H (I104) polyclonal antibody

Sign In for Pricing
View Details
Nori® Chicken PF4/CXCL4 ELISA Kit
GR114104 96 Well

Nori® Chicken PF4/CXCL4 ELISA Kit

Sign In for Pricing
View Details
Bovine DnaJ homolog subfamily B member 1, DNAJB1 ELISA KIT
ELI-02941b 96 Tests

Bovine DnaJ homolog subfamily B member 1, DNAJB1 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human STARD5 shRNA (UAS) - Lentiviral human STARD5 shRNA (UAS) (100)
GTR15330585 1 Vial

Lentiviral human STARD5 shRNA (UAS) - Lentiviral human STARD5 shRNA (UAS) (100)

Sign In for Pricing
View Details
PLXNC1 Protein Vector (Mouse) (pPB-N-His)
PV217387 500 ng

PLXNC1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CD5 monoclonal antibody
MB66113 50ul

CD5 monoclonal antibody

Sign In for Pricing
View Details