Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDE-IN-1
MF-0116217-01 10 mg

IDE-IN-1

Sign In for Pricing
View Details
IDE-IN-1
MF-0116217-02 50 mg

IDE-IN-1

Sign In for Pricing
View Details
HSPC302 (TBCK) (NM_033115) Human Tagged ORF Clone Lentiviral Particle
RC203605L1V 200 µL

HSPC302 (TBCK) (NM_033115) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Clostridium Novyi hisA Protein (aa 1-238)
VAng-Lsx9983-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Novyi hisA Protein (aa 1-238)

Sign In for Pricing
View Details
Mouse Monoclonal Lyn Antibody (LYN-01)
NB500-519 0.1 mg

Mouse Monoclonal Lyn Antibody (LYN-01)

Sign In for Pricing
View Details
Pan glycine myristoylation  Polyclonal Antibody
UB-GEN-10459 100 µL

Pan glycine myristoylation Polyclonal Antibody

Sign In for Pricing
View Details