Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SLC12A5/KCC2 Protein, N-His
E55P5327 50 µg

Recombinant Human SLC12A5/KCC2 Protein, N-His

Sign In for Pricing
View Details
Rabbit Polyclonal DACT3/Dapper 3 Antibody [CoraFluor 1]
NBP1-76340CL1 0.1 mL

Rabbit Polyclonal DACT3/Dapper 3 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Mouse Chrna7 (NM_007390) AAV Particle
MR224522A1V 250 µL

Mouse Chrna7 (NM_007390) AAV Particle

Sign In for Pricing
View Details
ANKRD50 (NM_020337) Human Over-expression Lysate
LY412567 100 µg

ANKRD50 (NM_020337) Human Over-expression Lysate

Sign In for Pricing
View Details
Dual Specificity Phosphatase 22 (DUSP22) Antibody
abx331759 100 µL

Dual Specificity Phosphatase 22 (DUSP22) Antibody

Sign In for Pricing
View Details
Fumarase protein
30R-1246 100 ug

Fumarase protein

Sign In for Pricing
View Details