Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLURP1 (FITC)
577108-01 50 µg

SLURP1 (FITC)

Sign In for Pricing
View Details
SLURP1 (FITC)
577108-02 100 µg

SLURP1 (FITC)

Sign In for Pricing
View Details
Rabbit Monoclonal IGSF3 Antibody (002) [PE]
NBP2-89880PE 0.1 mL

Rabbit Monoclonal IGSF3 Antibody (002) [PE]

Sign In for Pricing
View Details
RNY4P21 Protein Vector (Human) (pPM-C-HA)
40641021 500 ng

RNY4P21 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Differential Reinforced Clostridial
HiVeg® Broth Base
MV549-500G 500 g

Differential Reinforced Clostridial
HiVeg® Broth Base

Sign In for Pricing
View Details
MSK2 / RSK-B (RPS6KA4) (NM_003942) Human Tagged ORF Clone
RC212570 10 µg

MSK2 / RSK-B (RPS6KA4) (NM_003942) Human Tagged ORF Clone

Sign In for Pricing
View Details