Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO25 (F-box Only Protein 25, F-box Protein 25, FBX25, MGC20256, MGC51975) (MaxLight 490)
126677-ML490 100 µL

FBXO25 (F-box Only Protein 25, F-box Protein 25, FBX25, MGC20256, MGC51975) (MaxLight 490)

Sign In for Pricing
View Details
BORG4
308133 100 µL

BORG4

Sign In for Pricing
View Details
Mouse Polyribonucleotide Nucleotidyltransferase 1 (PNPT1) ELISA Kit
YP-W23807-01 48 Tests

Mouse Polyribonucleotide Nucleotidyltransferase 1 (PNPT1) ELISA Kit

Sign In for Pricing
View Details
Mouse Polyribonucleotide Nucleotidyltransferase 1 (PNPT1) ELISA Kit
YP-W23807-02 96 Tests

Mouse Polyribonucleotide Nucleotidyltransferase 1 (PNPT1) ELISA Kit

Sign In for Pricing
View Details
AP4S1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV630099 1.0 µg DNA

AP4S1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CACNG6 (NM_145814) Human Over-expression Lysate
LS059285-20ug 20 µg

CACNG6 (NM_145814) Human Over-expression Lysate

Sign In for Pricing
View Details