Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GNPDA2 Antibody [FITC]
NBP1-76997F 0.1 mL

Rabbit Polyclonal GNPDA2 Antibody [FITC]

Sign In for Pricing
View Details
Alg14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6642505 3x 1.0 µg

Alg14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit
MBS7205323-01 48 Well

Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit

Sign In for Pricing
View Details
Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit
MBS7205323-02 96 Well

Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit

Sign In for Pricing
View Details
Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit
MBS7205323-03 5x 96 Well

Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit

Sign In for Pricing
View Details
Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit
MBS7205323-04 10x 96 Well

Porcine Coatomer subunit zeta-1 (COPZ1) ELISA Kit

Sign In for Pricing
View Details