Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit
RD-COX4I1-Hu-48Tests 48 Tests

Human Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) ELISA Kit

Sign In for Pricing
View Details
Mlf1 (Myeloid Leukemia Factor 1, Hematopoietic Lineage Switch 7, Myelodysplasia-Myeloid Leukemia Factor 1, Mlf1, Hls7) (MaxLight 550)
MBS6457280-01 0.1 mL

Mlf1 (Myeloid Leukemia Factor 1, Hematopoietic Lineage Switch 7, Myelodysplasia-Myeloid Leukemia Factor 1, Mlf1, Hls7) (MaxLight 550)

Sign In for Pricing
View Details
Mlf1 (Myeloid Leukemia Factor 1, Hematopoietic Lineage Switch 7, Myelodysplasia-Myeloid Leukemia Factor 1, Mlf1, Hls7) (MaxLight 550)
MBS6457280-02 5x 0.1 mL

Mlf1 (Myeloid Leukemia Factor 1, Hematopoietic Lineage Switch 7, Myelodysplasia-Myeloid Leukemia Factor 1, Mlf1, Hls7) (MaxLight 550)

Sign In for Pricing
View Details
Human ASK1 ELISA Kit
E003421 1 Each

Human ASK1 ELISA Kit

Sign In for Pricing
View Details
Zinc finger protein 444 (ZNF444) Human ELISA Kit
I3588 96 Tests

Zinc finger protein 444 (ZNF444) Human ELISA Kit

Sign In for Pricing
View Details
PRAGMIN (SGK223, Tyrosine-protein Kinase SgK223, Sugen Kinase 223, DKFZp761P0423) (HRP)
125866-HRP 100 µL

PRAGMIN (SGK223, Tyrosine-protein Kinase SgK223, Sugen Kinase 223, DKFZp761P0423) (HRP)

Sign In for Pricing
View Details