Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-his.html

Purity

95.80

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) O75022 (G24-E443) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8592R) [DyLight 405]
NBP3-24094V 0.1 mL

Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8592R) [DyLight 405]

Sign In for Pricing
View Details
Olfr480 Mouse siRNA Oligo Duplex (Locus ID 56861)
SR411540 1 Kit

Olfr480 Mouse siRNA Oligo Duplex (Locus ID 56861)

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis rpsS Protein (aa 1-88) (strain HAR-13 / ATCC VR-571B)
VAng-Lsx7240-50gEcoli 50 µg (E. coli)

Recombinant Chlamydophila Trachomatis rpsS Protein (aa 1-88) (strain HAR-13 / ATCC VR-571B)

Sign In for Pricing
View Details
NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6721R-BF350-01 20 µL

NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6721R-BF350-02 100 µL

NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Recombinant Human Cysteine Dioxygenase Type 1 Protein
NBP1-30241 0.1 mg

Recombinant Human Cysteine Dioxygenase Type 1 Protein

Sign In for Pricing
View Details