Carnosine Dipeptidase 1/CNDP1, Human (HEK293, His)
Selected Variant
HY-P7740-01
Size: 10 µg
Carnosine Dipeptidase 1 Protein, Human (HEK293, His) is a human carnosine dipeptidase 1 protein with a his-flag, expressed in HEK293 cells. Carnosine Dipeptidase 1 is a member of the M20 metalloprotease family, encoded by the CNDP1 gene[1].
Product Specifications
Product Name Alternative
Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carnosine-dipeptidase-1-protein-human-hek293-his.html
Purity
95.00
Smiles
SPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLHHHHHHH
Molecular Formula
84735 (Gene_ID) Q96KN2 (S27-L506) (Accession)
Molecular Weight
60-90 kDa
References & Citations
[1]Michael Teufel, et al. Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase. J Biol Chem|[2]Peter Arner, et al. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. PLoS One. 2015 Apr 21;10 (4) :e0123566.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A04368-3-PE 100 µg/Vial
Anti-NCOA4 Antibody Picoband®, PE Conjugate
Sign In for Pricing
View Details 
PA1683-APC 100 µg/Vial
Anti-SLC22A6 Antibody Picoband®, APC Conjugate
Sign In for Pricing
View Details 
BNC470053-100 1x 100 µL
HCG-alpha (HCGa/53), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940185-500 1x 500 µL
Myogenin (MGN185), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Fibronectin Recombinant Rabbit Monoclonal Antibody [JF0582]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b3a/imageurl/et1702-25.webp)
ET1702-25 100 µL
Fibronectin Recombinant Rabbit Monoclonal Antibody [JF0582]
Sign In for Pricing
View Details 