Carnosine Dipeptidase 1/CNDP1, Human (HEK293, His)
Selected Variant
HY-P7740-01
Size: 10 µg
Carnosine Dipeptidase 1 Protein, Human (HEK293, His) is a human carnosine dipeptidase 1 protein with a his-flag, expressed in HEK293 cells. Carnosine Dipeptidase 1 is a member of the M20 metalloprotease family, encoded by the CNDP1 gene[1].
Product Specifications
Product Name Alternative
Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carnosine-dipeptidase-1-protein-human-hek293-his.html
Purity
95.00
Smiles
SPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLHHHHHHH
Molecular Formula
84735 (Gene_ID) Q96KN2 (S27-L506) (Accession)
Molecular Weight
60-90 kDa
References & Citations
[1]Michael Teufel, et al. Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase. J Biol Chem|[2]Peter Arner, et al. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. PLoS One. 2015 Apr 21;10 (4) :e0123566.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2871-500 1x 500 µL
Prostate Specific Antigen (PSA) (KLK3/2871R), 0.2mg/mL
Sign In for Pricing
View Details 
BNCB0303-100 1x 100 µL
Neurofilament (NF-L) (NR-4), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PA1964-Dylight594 100 µg
Anti-DDX5 Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details 
PA1821-carrier-free 100 µg/Vial
Anti-Kallikrein 10/KLK10 Antibody Picoband®, Carrier-free
Sign In for Pricing
View Details 
RP1105-Biotin 100 µg/Vial
Anti-CD33 Antibody Picoband® (Biotine Conjugate)
Sign In for Pricing
View Details