Carnosine Dipeptidase 1/CNDP1, Human (HEK293, His)
Carnosine Dipeptidase 1 Protein, Human (HEK293, His) is a human carnosine dipeptidase 1 protein with a his-flag, expressed in HEK293 cells. Carnosine Dipeptidase 1 is a member of the M20 metalloprotease family, encoded by the CNDP1 gene[1].
Product Specifications
Product Name Alternative
Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carnosine-dipeptidase-1-protein-human-hek293-his.html
Purity
95.00
Smiles
SPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLHHHHHHH
Molecular Formula
84735 (Gene_ID) Q96KN2 (S27-L506) (Accession)
Molecular Weight
60-90 kDa
References & Citations
[1]Michael Teufel, et al. Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase. J Biol Chem|[2]Peter Arner, et al. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. PLoS One. 2015 Apr 21;10 (4) :e0123566.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details