Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (His-SUMO)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (His-SUMO) is the recombinant human-derived GFRAL protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-his-sumo.html

Purity

93.00

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

Approximately 53.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)
MBS1195298-01 0.02 mg (E-Coli)

Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)

Ask
View Details
Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)
MBS1195298-02 0.1 mg (E-Coli)

Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)

Ask
View Details
Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)
MBS1195298-03 0.02 mg (Yeast)

Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)

Ask
View Details
Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)
MBS1195298-04 0.1 mg (Yeast)

Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)

Ask
View Details
Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)
MBS1195298-05 0.02 mg (Baculovirus)

Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)

Ask
View Details
Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)
MBS1195298-06 1 mg (E-Coli)

Recombinant Thermococcus sibiricus V-type ATP synthase subunit F (atpF)

Ask
View Details