Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (His-SUMO)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (His-SUMO) is the recombinant human-derived GFRAL protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-his-sumo.html

Purity

93.00

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

Approximately 53.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit
MBS7234579-01 48 Well

Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit

Ask
View Details
Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit
MBS7234579-02 96 Well

Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit

Ask
View Details
Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit
MBS7234579-03 5x 96 Well

Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit

Ask
View Details
Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit
MBS7234579-04 10x 96 Well

Rat AN1-type zinc finger protein 2A (ZFAND2A) ELISA Kit

Ask
View Details
TRIM13 Overexpression Lysate (Native) - (Dry Ice)
NBL1-17276 0.1 mg

TRIM13 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Lentiviral human CA12 shRNA (UAS) - Lentiviral human CA12 shRNA (UAS, GFP) (100)
GTR15078153 1 Vial

Lentiviral human CA12 shRNA (UAS) - Lentiviral human CA12 shRNA (UAS, GFP) (100)

Ask
View Details