Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

Product Specifications

Product Name Alternative

Alpha-HL; Alpha-toxin

Abbreviation

Recombinant Staphylococcus aureus hly protein

Gene Name

Hly

UniProt

P09616

Expression Region

27-319aa

Organism

Staphylococcus aureus

Target Sequence

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN

Tag

Tag-Free

Type

In Stock Protein

Source

Yeast

Field of Research

Microbiology

Relevance

Alpha-toxin binds to the membrane of eukaryotic cells (particularly red blood cells, RBC) forming pores, resulting in hemolysis, with the release of low-molecular weight molecules leading to eventual osmotic RBC lysis. Human RBCs bind much less alpha-toxin than do rabbit RBCs. Heptamer oligomerization and pore formation is required for lytic activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79a (IGA/515), CF568 conjugate, 0.1mg/mL
BNC680515-100 1x 100 µL

CD79a (IGA/515), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human VEGF-B/VEGFB Protein (Fc Tag)
PKSH033474-01 10 µg

Recombinant Human VEGF-B/VEGFB Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human VEGF-B/VEGFB Protein (Fc Tag)
PKSH033474-02 50 µg

Recombinant Human VEGF-B/VEGFB Protein (Fc Tag)

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[YTS169.4]
AN004080-01 100 µg

AF/LE Purified Anti-Mouse CD8a Antibody[YTS169.4]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[YTS169.4]
AN004080-02 1 mg

AF/LE Purified Anti-Mouse CD8a Antibody[YTS169.4]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD8a Antibody[YTS169.4]
AN004080-03 5 mg

AF/LE Purified Anti-Mouse CD8a Antibody[YTS169.4]

Sign In for Pricing
View Details