Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (227a.a, His)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (227a.a, His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

OSM Protein, Human (227a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-227a-a-his.html

Purity

95.00

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R252) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECFP-Tag Antibody (8F6) , HRP Conjugated
N1103-01 50 µL

ECFP-Tag Antibody (8F6) , HRP Conjugated

Sign In for Pricing
View Details
ECFP-Tag Antibody (8F6) , HRP Conjugated
N1103-02 100 µL

ECFP-Tag Antibody (8F6) , HRP Conjugated

Sign In for Pricing
View Details
ECFP-Tag Antibody (8F6) , HRP Conjugated
N1103-03 500 µL

ECFP-Tag Antibody (8F6) , HRP Conjugated

Sign In for Pricing
View Details
Mouse Parathyroid Hormone Related Protein (PTHrP) ELISA Kit
RD-PTHrP-Mu-48Tests 48 Tests

Mouse Parathyroid Hormone Related Protein (PTHrP) ELISA Kit

Sign In for Pricing
View Details
Anti-Calretinin Antibody
303-CALt 25 µL

Anti-Calretinin Antibody

Sign In for Pricing
View Details
Phpt1 Antibody - C-terminal region : FITC (ARP54984_P050-FITC)
ARP54984_P050-FITC 100 µL

Phpt1 Antibody - C-terminal region : FITC (ARP54984_P050-FITC)

Sign In for Pricing
View Details