Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human R-spondin-1 (RSPO1), partial (Active)

Product Specifications

Product Name Alternative

(Roof plate-specific spondin-1) (hRspo1)

Abbreviation

Recombinant Human RSPO1 protein, partial (Active)

Gene Name

RSPO1

UniProt

Q2MKA7

Expression Region

31-263aa

Organism

Homo sapiens (Human)

Target Sequence

RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Tag

C-terminal 10xHis-Avi-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Developmental Biology

Relevance

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

YES

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5 (CSB-MP012906HU1), the EC50 is 124.0-174.1 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTCD3 Adenovirus (Rat)
38061056 1.0 mL

PTCD3 Adenovirus (Rat)

Sign In for Pricing
View Details
Dab1 (G-5)
sc-271136 200 µg/mL

Dab1 (G-5)

Sign In for Pricing
View Details
ARHGDIG-set siRNA/shRNA/RNAi Lentivector (Human)
12318091 4x 500 ng

ARHGDIG-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
CCT4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV720671 1.0 µg DNA

CCT4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LO-4-25
HY-176067 1 Each

LO-4-25

Sign In for Pricing
View Details
Picrolonic acid
HY-W127746-01 250 mg

Picrolonic acid

Sign In for Pricing
View Details