Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Human (HEK293, His)

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-human-hek293-his.html

Purity

98.0

Smiles

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

Molecular Formula

7035 (Gene_ID) P10646/NP_006278.1 (D29-K282) (Accession)

Molecular Weight

42-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD33 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
TA506335 100 µL

CD33 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Rabbit Polyclonal SARM1 Antibody [PerCP]
NBP2-41180PCP 0.1 mL

Rabbit Polyclonal SARM1 Antibody [PerCP]

Sign In for Pricing
View Details
Rabbit Polyclonal YLPM1 Antibody
NBP2-56737 100 µL

Rabbit Polyclonal YLPM1 Antibody

Sign In for Pricing
View Details
SELE Antibody
A57347-50UG 50 µg

SELE Antibody

Sign In for Pricing
View Details
ADAMTS3 Antibody
E300357a 200 µL

ADAMTS3 Antibody

Sign In for Pricing
View Details
CEP-33779
C08874-01 5 mg

CEP-33779

Sign In for Pricing
View Details