Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Human (HEK293, His)

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-human-hek293-his.html

Purity

98.0

Smiles

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

Molecular Formula

7035 (Gene_ID) P10646/NP_006278.1 (D29-K282) (Accession)

Molecular Weight

42-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmbim1 (BC004752) Mouse Tagged ORF Clone
MG201305 10 µg

Tmbim1 (BC004752) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human PPAN activation kit by CRISPRa
GA111185 1 Kit

Human PPAN activation kit by CRISPRa

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF594 conjugate, 0.1mg/mL
BNC942755-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS706811 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
DNMT3L (NM_013369) Human Over-expression Lysate
LC402250 20 µg

DNMT3L (NM_013369) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560402 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details