Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Human (HEK293, His)

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-human-hek293-his.html

Purity

98.0

Smiles

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

Molecular Formula

7035 (Gene_ID) P10646/NP_006278.1 (D29-K282) (Accession)

Molecular Weight

42-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Polyporus squamosus Lectin (mushroom) -PSL-
R-9006-1 1 mg

TRITC Conjugated Polyporus squamosus Lectin (mushroom) -PSL-

Sign In for Pricing
View Details
gamma Catenin (JUP) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF812395 100 µg

gamma Catenin (JUP) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF594 conjugate, 0.1mg/mL
BNC941930-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details