TFPI, Human (HEK293, His)
TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TFPI Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tfpi-protein-human-hek293-his.html
Purity
98.0
Smiles
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
Molecular Formula
7035 (Gene_ID) P10646/NP_006278.1 (D29-K282) (Accession)
Molecular Weight
42-45 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RR207327L4V 200 µL
Scara3 (NM_001108870) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 129852-APC 100 µL
MRP5 (Multidrug Resistance-associated Protein 5, ATP-binding Cassette Sub-family C Member 5, Multi-specific Organic Anion Transporter C, MOAT-C, pABC11, SMRP, ABCC5) (APC)
Sign In for Pricing
View Details 
GTR15366364 1 Vial
Lentiviral human LHX1 sgRNA gene knockout kit - Lentiviral human LHX1 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 