Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin-like 1/CLUL1, Human (HEK293, His)

Clusterin-like protein 1/CLUL1 Protein belongs to the clusterin family.Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) is the recombinant human-derived Clusterin-like protein 1/CLUL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-like-protein-1-clul1-protein-human-hek-293-his.html

Purity

93.00

Smiles

APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESA

Molecular Formula

27098 (Gene_ID) Q15846 (A21-A442) (Accession)

Molecular Weight

The protein migrates as 59-80 kDa under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRS2 Polyclonal Antibody, Cy5 Conjugated
bs-17836R-Cy5 100 µL

MRS2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MOT3 Polyclonal Antibody
MBS7159964 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MOT3 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CANT1 Protein, N-His
orb3060702-01 50 µg

Recombinant Human CANT1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CANT1 Protein, N-His
orb3060702-02 100 µg

Recombinant Human CANT1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CANT1 Protein, N-His
orb3060702-03 1 mg

Recombinant Human CANT1 Protein, N-His

Sign In for Pricing
View Details
SERBP1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-6734R-PerCP-Cy5.5 100 µL

SERBP1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details