Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Envelope phospholipase F13 (F13L)

Product Specifications

Product Name Alternative

(37 kDa protein) (Envelope protein F13) (Palmitoylated EV membrane protein) (p37K)

Abbreviation

Recombinant Vaccinia virus F13L protein

Gene Name

F13L

UniProt

P26653

Expression Region

1-372aa

Organism

Vaccinia virus (strain IHD-J) (VACV)

Target Sequence

MWPFAPVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKGIKIIVLLDERGKRNLGELQSHCPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Major envelope protein that plays a role in the biogenesis of the viral double membrane and in egress of virus from the host cell. Produces the wrapped form of virus that is required for cell-to-cell spread. Acts as a lipase with broad specificity including phospholipase C, phospholipase A, and triacylglycerol lipase activities.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.2 kDa

References & Citations

"A mutation in the gene encoding the vaccinia virus 37,000-M (r) protein confers resistance to an inhibitor of virus envelopment and release." Schmutz C., Payne L.G., Gubser J., Wittek R. J. Virol. 65:3435-3442 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Gastrin Antibody
MBS4506243-01 0.05 mL

Rabbit anti-Gastrin Antibody

Sign In for Pricing
View Details
Rabbit anti-Gastrin Antibody
MBS4506243-02 0.1 mL

Rabbit anti-Gastrin Antibody

Sign In for Pricing
View Details
Rabbit anti-Gastrin Antibody
MBS4506243-03 5x 0.1 mL

Rabbit anti-Gastrin Antibody

Sign In for Pricing
View Details
Lce1f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3219308 1.0 µg DNA

Lce1f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Olr313 Recombinant Protein (Rat)
RP217229 100 µg

Olr313 Recombinant Protein (Rat)

Sign In for Pricing
View Details
RAB11FIP4 Polyclonal Antibody
MBS8570596-01 0.1 mL

RAB11FIP4 Polyclonal Antibody

Sign In for Pricing
View Details