Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus mutans serotype c Glucosyltransferase-I (gtfB), partial

Product Specifications

Product Name Alternative

(GTF-I) (Dextransucrase) (Sucrose 6-glucosyltransferase)

Abbreviation

Recombinant Streptococcus mutans serotype c gtfB protein, partial

Gene Name

GtfB

UniProt

P08987

Expression Region

426-597aa

Organism

Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

Target Sequence

WLHFLMNFGNIYANDPDANFDSIRVDAVDNVDADLLQIAGDYLKAAKGIHKNDKAANDHLSILEAWSDNDTPYLHDDGDNMINMDNKLRLSLLFSLAKPLNQRSGMNPLITNSLVNRTDDNAETAAVPSYSFIRAHDSEVQDLIRDIIKAEINPNVVGYSFTMEEIKKAFEI

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Production of extracellular glucans, that are thought to play a key role in the development of the dental plaque because of their ability to adhere to smooth surfaces and mediate the aggregation of bacterial cells and food debris.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.8 kDa

References & Citations

"Genome sequence of Streptococcus mutans UA159, a cariogenic dental pathogen." Ajdic D.J., McShan W.M., McLaughlin R.E., Savic G., Chang J., Carson M.B., Primeaux C., Tian R., Kenton S., Jia H.G., Lin S.P., Qian Y., Li S., Zhu H., Najar F.Z., Lai H., White J., Roe B.A., Ferretti J.J. Proc. Natl. Acad. Sci. U.S.A. 99:14434-14439 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAR6 rabbit pAb
RA35072-01 50 µL

STAR6 rabbit pAb

Sign In for Pricing
View Details
STAR6 rabbit pAb
RA35072-02 100 µL

STAR6 rabbit pAb

Sign In for Pricing
View Details
PRB3 Double Nickase Plasmid (h)
sc-405488-NIC 20 µg

PRB3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
CtIP (RBBP8) (NM_203291) Human Tagged ORF Clone Lentiviral Particle
RC221624L4V 200 µL

CtIP (RBBP8) (NM_203291) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PRX2 shRNA (m) Lentiviral Particles
sc-152532-V 200 µL

PRX2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Bt Cry1Ab/AC antibody
10-1400 1 mg

Bt Cry1Ab/AC antibody

Sign In for Pricing
View Details