Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC10A/CD301, Human (HEK293, His)

CLEC10A/CD301 Protein, implicated in probable immune response regulation, binds Tn-Ag sugar moieties in a calcium-dependent manner. Recognizing these structures on carcinoma cells, CLEC10A/CD301 suggests a role in immune surveillance. Further exploration of its molecular interactions and downstream signaling pathways will enhance understanding of its contributions to immune modulation, especially in the context of cancer immunity. CLEC10A/CD301 Protein, Human (HEK293, His) is the recombinant human-derived CLEC10A/CD301 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CLEC10A/CD301 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec10a-cd301-protein-human-hek-293-his.html

Purity

98.0

Smiles

QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Molecular Formula

10462 (Gene_ID) Q8IUN9-1 (Q61-H316) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-500 1x 500 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-500 1x 500 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), 1mg/mL
BNUM0096-50 1x 50 µL

Histone H1 (AE-4), 1mg/mL

Sign In for Pricing
View Details
Vimentin (VM452), CF568 conjugate, 0.1mg/mL
BNC680452-100 1x 100 µL

Vimentin (VM452), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details