Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 eta, Human (GST)

YWHAH proteins are adapter proteins in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and regulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity and interacts with nuclear hormone receptors (AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, THRA) and cofactors. 14-3-3 eta Protein, Human (GST) is the recombinant human-derived YWHAH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

14-3-3 eta Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ywhah-protein-human-gst.html

Purity

94.00

Smiles

REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Molecular Formula

7533 (Gene_ID) Q04917 (R4-N246) (Accession)

Molecular Weight

Approximately 54.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBB Antibody, Biotin conjugated
A76729-50UL 50 μL

UBB Antibody, Biotin conjugated

Sign In for Pricing
View Details
PODNL1 (NM_001146255) Human Tagged ORF Clone
RC228336 10 µg

PODNL1 (NM_001146255) Human Tagged ORF Clone

Sign In for Pricing
View Details
DUS3L Antibody
CSB-PA007236GA01HU 100 µL

DUS3L Antibody

Sign In for Pricing
View Details
AWRI1631_112270 Antibody
orb851099 2 mg

AWRI1631_112270 Antibody

Sign In for Pricing
View Details
X99384 3'UTR GFP Stable Cell Line
TU172357 1.0 mL

X99384 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Slc22a4 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3465302 1.0 µg DNA

Slc22a4 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details