Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium acetobutylicum Acetoacetate decarboxylase (adc)

Product Specifications

Product Name Alternative

(AAD) (ADC)

Abbreviation

Recombinant Clostridium acetobutylicum Acetoacetate decarboxylase protein

Gene Name

Adc

UniProt

P23670

Expression Region

1-244aa

Organism

Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Target Sequence

MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFARTMLKDEVIKQISTPLTSPAFPRGPYKFHNREYFNIVYRTDMDALRKVVPEPLEIDEPLVRFEIMAMHDTSGLGCYTESGQAIPVSFNGVKGDYLHMMYLDNEPAIAVGRELSAYPKKLGYPKLFVDSDTLVGTLDYGKLRVATATMGYKHKALDANEAKDQICRPNYMLKIIPNYDGSPRICELINAKITDVTVHEAWTGPTRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEVIYDYLK

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Catalyzes the conversion of acetoacetate to acetone and carbon dioxide.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.2 kDa

References & Citations

"The origin of the electrostatic perturbation in acetoacetate decarboxylase." Ho MC, Ménétret JF, Tsuruta H, Allen KN. Nature 459 393-7 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-SAK Antibody
MBS4508443-01 0.05 mL

Rabbit anti-SAK Antibody

Sign In for Pricing
View Details
Rabbit anti-SAK Antibody
MBS4508443-02 0.1 mL

Rabbit anti-SAK Antibody

Sign In for Pricing
View Details
Rabbit anti-SAK Antibody
MBS4508443-03 5x 0.1 mL

Rabbit anti-SAK Antibody

Sign In for Pricing
View Details
Anti-NALP2 Rabbit pAb
GB114502 100 μL

Anti-NALP2 Rabbit pAb

Sign In for Pricing
View Details
Goat Integrin-linked kinase1 (ILK-1) ELISA Kit
EIA05910Go 1 Kit

Goat Integrin-linked kinase1 (ILK-1) ELISA Kit

Sign In for Pricing
View Details
MICB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1301807 1.0 µg DNA

MICB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details