Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein C-IV (APOC4)

Product Specifications

CAS Number

9000-83-3

Gene Name

APOC4

UniProt

P55056

Expression Region

27-127aa

Organism

Homo sapiens

Target Sequence

CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Field of Research

Others

Assay Type

Developed Protein

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.8 kDa

References & Citations

"DNA sequence variation in human apolipoprotein C4 gene and its effect on plasma lipid profile." Kamboh M.I., Aston C.E., Hamman R.F. Atherosclerosis 152:193-201 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRP7B AAV Vector (Human) (CMV)
42759101 1 µg

RRP7B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human VISTA/B7-H5/PD-1H Alexa Fluor 350 Antibody
FAB71261U-100UG 100 µg

Human VISTA/B7-H5/PD-1H Alexa Fluor 350 Antibody

Sign In for Pricing
View Details
RGD1566243 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6048105 3x 1.0 µg

RGD1566243 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (AP)
MBS6162974-01 0.1 mL

CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (AP)

Sign In for Pricing
View Details
CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (AP)
MBS6162974-02 5x 0.1 mL

CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (AP)

Sign In for Pricing
View Details
Universal ST;5-HT ELISA Kit
E107068 1 Each

Universal ST;5-HT ELISA Kit

Sign In for Pricing
View Details