Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein GPR107 (GPR107), partial

Product Specifications

Product Name Alternative

(Lung seven transmembrane receptor 1)

Abbreviation

Recombinant Human GPR107 protein, partial

Gene Name

GPR107

UniProt

Q5VW38

Expression Region

40-263aa

Organism

Homo sapiens (Human)

Target Sequence

RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Has been proposed to act as a receptor for neuronostatin, a peptide derived from the somatostatin/SST precursor. Involved in blood sugar regulation through the induction of glucagon in response to low glucose. ; (Microbial infection) Required for intoxication by Pseudomonas aeruginosa exotoxin A and Campylobacter jejuni CDT. May contribute to the retrograde transport of bacterial toxins, including cholera toxin, from the trans-Golgi network to the endoplasmic reticulum.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

"Novel putative G protein-coupled receptors cloned from lung." Edgar A.J., Polak J.M. J. Anat. 200:202-202 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS4 Antibody (Biotin)
KB-27451-01 50 μL

ADAMTS4 Antibody (Biotin)

Sign In for Pricing
View Details
ADAMTS4 Antibody (Biotin)
KB-27451-02 100 µL

ADAMTS4 Antibody (Biotin)

Sign In for Pricing
View Details
ADAMTS4 Antibody (Biotin)
KB-27451-03 1 mL

ADAMTS4 Antibody (Biotin)

Sign In for Pricing
View Details
Divinylbenzene;m-(or p-)Divinylbenzene
TRC-D494873-50MG 50 mg

Divinylbenzene;m-(or p-)Divinylbenzene

Sign In for Pricing
View Details
Human PIGX activation kit by CRISPRa
GA110411 1 Kit

Human PIGX activation kit by CRISPRa

Sign In for Pricing
View Details
Human TTC30B activation kit by CRISPRa
GA115766 1 Kit

Human TTC30B activation kit by CRISPRa

Sign In for Pricing
View Details