Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Human (CHO)

IL-18BP Protein, Human (CHO) Binding Protein (CHO-expressed) is a modulator of the Th1 cytokine response.

Product Specifications

Product Name Alternative

IL-18BP Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-human-cho.html

Purity

95.0

Smiles

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Molecular Formula

10068 (Gene_ID) O95998-2 (T31-G194) (Accession)

Molecular Weight

Approximately 42-44 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Novick D, et al. Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response. Immunity. 1999 Jan;10 (1) :127-36.|[2]C. Dinarello, et al. Targeting interleukin 18 with interleukin 18 binding protein. Ann Rheum Dis. 2000 Nov; 59 (Suppl 1) : i17–i20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ntrk2, ID (Ntrk2, Trkb, BDNF/NT-3 growth factors receptor, GP145-TrkB/GP95-TrkB, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase) (MaxLight 490)
MBS6327013-01 0.1 mL

Ntrk2, ID (Ntrk2, Trkb, BDNF/NT-3 growth factors receptor, GP145-TrkB/GP95-TrkB, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase) (MaxLight 490)

Ask
View Details
Ntrk2, ID (Ntrk2, Trkb, BDNF/NT-3 growth factors receptor, GP145-TrkB/GP95-TrkB, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase) (MaxLight 490)
MBS6327013-02 5x 0.1 mL

Ntrk2, ID (Ntrk2, Trkb, BDNF/NT-3 growth factors receptor, GP145-TrkB/GP95-TrkB, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase) (MaxLight 490)

Ask
View Details
CFDA SE Cell Proliferation and Cell Tracking Kit
ABC-BR0023 500 T, 1000 T

CFDA SE Cell Proliferation and Cell Tracking Kit

Ask
View Details
CEBPA antibody
10R-1556 100 ug

CEBPA antibody

Ask
View Details
Recombinant Human TRAF3IP1 Protein
E30P8048 20 µg

Recombinant Human TRAF3IP1 Protein

Ask
View Details
Human GIMAP6 Recombinant Protein
PROTQ6P9H5-500ug 500 µg

Human GIMAP6 Recombinant Protein

Ask
View Details